Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|438
Gene name
LocationContig_11:27270..28544
Strand-
Gene length (bp)1274
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.2E-26 127 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 92 350 8.0E-34
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 118 348 1.0E-30
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 125 337 6.0E-14
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 73 257 5.0E-12
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 124 293 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 92 350 8.0E-34
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 118 348 1.0E-30
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 125 337 6.0E-14
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 73 257 5.0E-12
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 124 293 4.0E-10
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 128 260 8.0E-10
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 129 268 1.0E-09
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 133 250 9.0E-09
sp|P50850|YLXY_BACSU Uncharacterized protein YlxY OS=Bacillus subtilis (strain 168) GN=ylxY PE=3 SV=2 143 341 3.0E-08
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 133 328 4.0E-08
sp|P04676|NODB_RHILT Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. trifolii GN=nodB PE=3 SV=1 112 204 2.0E-07
sp|Q06703|CDA2_YEAST Chitin deacetylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA2 PE=1 SV=1 133 340 3.0E-07
sp|O07596|YHEN_BACSU Putative polysaccharide deacetylase YheN OS=Bacillus subtilis (strain 168) GN=yheN PE=3 SV=1 133 251 3.0E-07
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 133 250 3.0E-07
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 120 204 3.0E-07
sp|O34928|PDAA_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) GN=pdaA PE=1 SV=1 129 268 2.0E-06
sp|P94361|YXKH_BACSU Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) GN=yxkH PE=3 SV=1 123 291 3.0E-06
sp|P04339|NODB_RHILV Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. viciae GN=nodB PE=3 SV=1 116 204 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|438
MIFPISLVALAAIVTARIPPMNTLDTFSLDNYDTIGDAASSYIVHRKTRKPFRCSFISPARLCPEGFCCNYVWDT
CGKGLKYCSDHFCQVKFSTACDQFVSPKGKYTKNIPRPHNSKVPYGKLLTKCKKPGMIALTYDDGPFEHTDRLLD
ILKKYNVKATFFISGNNRRKGFIDDPATPWPEVLHRMHREGHQLASHAWTHRNLFKLTWEWDYDRVHDGPGMREN
QIVYNEMAFRNLFGWTPTYFRAPFGACHKPCRKFLADMGYHLIGQTNTLKDQKESVRKSLERIRLSFRSRWHSRH
SIIIQSSDVQWKSIEHLTPSIIRRGRELGWHFATIGECMGDPKENWYRQAAFLDDINPWTPMNASRSGVPLFSKN
ATSKSKPRL*
Coding >OphauG2|438
ATGATATTCCCAATCTCCCTCGTCGCGCTCGCTGCCATTGTCACGGCCAGGATTCCCCCAATGAATACCCTTGAC
ACTTTTAGCCTTGACAACTACGACACAATCGGCGACGCAGCAAGCTCGTACATTGTCCACCGCAAAACGAGAAAA
CCGTTTCGCTGTTCCTTTATTTCTCCCGCTCGTCTCTGTCCAGAGGGATTCTGCTGCAACTATGTTTGGGATACG
TGTGGCAAGGGTCTCAAGTATTGCTCAGATCACTTTTGCCAGGTCAAGTTTAGCACCGCGTGCGACCAATTTGTC
TCCCCCAAAGGGAAATATACCAAGAATATTCCTCGCCCGCACAATAGCAAAGTCCCATATGGAAAACTCTTGACG
AAATGCAAGAAACCTGGCATGATTGCCCTCACATACGATGACGGCCCCTTTGAACACACTGACCGACTCCTCGAT
ATTCTCAAAAAATACAACGTCAAGGCAACATTCTTCATCAGCGGCAACAACCGGCGCAAGGGCTTCATCGATGAC
CCTGCCACGCCTTGGCCCGAGGTCCTCCACCGCATGCACCGCGAAGGACACCAGCTCGCCAGCCACGCCTGGACG
CACCGAAACCTCTTTAAGCTGACCTGGGAATGGGACTATGACCGAGTTCATGACGGACCCGGCATGCGCGAGAAC
CAAATCGTCTACAATGAAATGGCCTTTCGCAATCTTTTTGGCTGGACGCCCACTTACTTTCGCGCCCCCTTTGGC
GCCTGCCATAAACCATGTCGCAAGTTTCTCGCCGACATGGGCTATCATCTCATTGGCCAGACAAACACTCTCAAG
GATCAGAAAGAGAGTGTGAGAAAGTCTTTGGAGCGCATCCGTCTGTCGTTTCGCTCGCGGTGGCATTCGCGCCAT
AGCATCATTATCCAGAGCAGTGATGTGCAATGGAAGTCGATTGAGCACTTGACGCCGAGTATTATTCGGAGGGGG
AGGGAGTTGGGATGGCACTTTGCCACGATTGGCGAGTGCATGGGCGACCCCAAGGAAAATTGGTATCGTCAGGCG
GCCTTTTTGGACGACATTAATCCTTGGACCCCGATGAATGCAAGTAGATCGGGTGTTCCTCTCTTTTCCAAGAAT
GCCACTTCTAAGAGCAAACCGAGACTTTGA
Transcript >OphauG2|438
ATGATATTCCCAATCTCCCTCGTCGCGCTCGCTGCCATTGTCACGGCCAGGATTCCCCCAATGAATACCCTTGAC
ACTTTTAGCCTTGACAACTACGACACAATCGGCGACGCAGCAAGCTCGTACATTGTCCACCGCAAAACGAGAAAA
CCGTTTCGCTGTTCCTTTATTTCTCCCGCTCGTCTCTGTCCAGAGGGATTCTGCTGCAACTATGTTTGGGATACG
TGTGGCAAGGGTCTCAAGTATTGCTCAGATCACTTTTGCCAGGTCAAGTTTAGCACCGCGTGCGACCAATTTGTC
TCCCCCAAAGGGAAATATACCAAGAATATTCCTCGCCCGCACAATAGCAAAGTCCCATATGGAAAACTCTTGACG
AAATGCAAGAAACCTGGCATGATTGCCCTCACATACGATGACGGCCCCTTTGAACACACTGACCGACTCCTCGAT
ATTCTCAAAAAATACAACGTCAAGGCAACATTCTTCATCAGCGGCAACAACCGGCGCAAGGGCTTCATCGATGAC
CCTGCCACGCCTTGGCCCGAGGTCCTCCACCGCATGCACCGCGAAGGACACCAGCTCGCCAGCCACGCCTGGACG
CACCGAAACCTCTTTAAGCTGACCTGGGAATGGGACTATGACCGAGTTCATGACGGACCCGGCATGCGCGAGAAC
CAAATCGTCTACAATGAAATGGCCTTTCGCAATCTTTTTGGCTGGACGCCCACTTACTTTCGCGCCCCCTTTGGC
GCCTGCCATAAACCATGTCGCAAGTTTCTCGCCGACATGGGCTATCATCTCATTGGCCAGACAAACACTCTCAAG
GATCAGAAAGAGAGTGTGAGAAAGTCTTTGGAGCGCATCCGTCTGTCGTTTCGCTCGCGGTGGCATTCGCGCCAT
AGCATCATTATCCAGAGCAGTGATGTGCAATGGAAGTCGATTGAGCACTTGACGCCGAGTATTATTCGGAGGGGG
AGGGAGTTGGGATGGCACTTTGCCACGATTGGCGAGTGCATGGGCGACCCCAAGGAAAATTGGTATCGTCAGGCG
GCCTTTTTGGACGACATTAATCCTTGGACCCCGATGAATGCAAGTAGATCGGGTGTTCCTCTCTTTTCCAAGAAT
GCCACTTCTAAGAGCAAACCGAGACTTTGA
Gene >OphauG2|438
ATGATATTCCCAATCTCCCTCGTCGCGCTCGCTGCCATTGTCACGGCCAGGATTCCCCCAATGAATACCCTTGAC
ACTTTTAGCCTTGACAACTACGACACAATCGGCGACGCAGCAAGCTCGTACATTGTCCACCGCAAAACGAGAAAA
CCGTTTCGCTGTTCCTTTATTTCTCCCGCTCGTCTCTGTCCAGAGGGATTCTGCTGCAACTATGTTTGGGATACG
TGTGGCAAGGGTCTCAAGTATTGCTCAGATCACTTTTGCCAGGTCAAGTTTAGCACCGCGTGCGACCAATTGTCA
GTCCCTTGCATGAAGCTATTTCGAGTTGTAAAGATACTGATGGGTAATAGTGTCTCCCCCAAAGGGAAATATACC
AAGAATATTCCTCGCCCGCACAATAGCAAAGTCCCATATGGTTCGTTCCCCCCTTTAATCTTGGAAACTTGCCCA
CGCCATGCTTAGCCAACTCTTGCTACTTAGGAAAACTCTTGACGAAATGCAAGAAACCTGGCATGATTGCCCTCA
CATACGATGACGGCCCCTTTGAACACACTGACCGACTCCTCGATATTCTCAAAAAATACAACGTCAAGGCAACAT
TCTTCATCAGCGGCAACAACCGGCGCAAGGGCTTCATCGATGACCCTGCCACGCCTTGGCCCGAGGTCCTCCACC
GCATGCACCGCGAAGGACACCAGCTCGCCAGCCACGCCTGGACGCACCGAAACCTCTTTAAGCTGACCTGGGAAT
GGGACTATGACCGAGTTCATGACGGACCCGGCATGCGCGAGAACCAAATCGTCTACAATGAAATGGCCTTTCGCA
ATCTTTTTGGCTGGACGCCCACTTACTTTCGCGCCCCCTTTGGCGCCTGCCATAAACCATGTCGCAAGTTTCTCG
CCGACATGGGCTATCATCTCATTGGCCAGACAAACACTCTCAAGGATCAGAAAGAGAGTGTGAGAAAGTCTTTGG
AGCGCATCCGTCTGTCGTTTCGCTCGCGGTGGCATTCGCGCCATAGCATCATTATCCAGAGCAGTGATGTGCAAT
GGAAGTCGATTGAGCACTTGACGCCGAGTATTATTCGGAGGGGGAGGGAGTTGGGATGGCACTTTGCCACGATTG
GCGAGTGCATGGGCGACCCCAAGGAAAATTGGTATCGTCAGGCGGCCTTTTTGGACGACATTAATCCTTGGACCC
CGATGAATGCAAGTAGATCGGGTGTTCCTCTCTTTTCCAAGAATGCCACTTCTAAGAGCAAACCGAGACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail