Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4370
Gene name
LocationContig_362:2414..4262
Strand-
Gene length (bp)1848
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04410 Gar1 Gar1/Naf1 RNA binding region 1.6E-22 231 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14360|NAF1_SCHPO H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naf1 PE=1 SV=1 208 359 6.0E-24
sp|Q96HR8|NAF1_HUMAN H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens GN=NAF1 PE=1 SV=2 207 382 1.0E-18
sp|A6ZRW0|NAF1_YEAS7 H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NAF1 PE=3 SV=1 182 361 2.0E-18
sp|P53919|NAF1_YEAST H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAF1 PE=1 SV=1 182 361 2.0E-18
sp|Q3UMQ8|NAF1_MOUSE H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Mus musculus GN=Naf1 PE=1 SV=2 207 424 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14360|NAF1_SCHPO H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naf1 PE=1 SV=1 208 359 6.0E-24
sp|Q96HR8|NAF1_HUMAN H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens GN=NAF1 PE=1 SV=2 207 382 1.0E-18
sp|A6ZRW0|NAF1_YEAS7 H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NAF1 PE=3 SV=1 182 361 2.0E-18
sp|P53919|NAF1_YEAST H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAF1 PE=1 SV=1 182 361 2.0E-18
sp|Q3UMQ8|NAF1_MOUSE H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Mus musculus GN=Naf1 PE=1 SV=2 207 424 2.0E-18
sp|Q52KK4|NAF1_RAT H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Rattus norvegicus GN=Naf1 PE=1 SV=1 207 376 2.0E-17
sp|Q9VJ62|NAF1_DROME H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Drosophila melanogaster GN=CG10341 PE=1 SV=2 206 344 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0042254 ribosome biogenesis Yes
GO:0001522 pseudouridine synthesis Yes
GO:0071840 cellular component organization or biogenesis No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0009451 RNA modification No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044085 cellular component biogenesis No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4370
MIDHQPPSPASITFALEAALGGLPDAISTQDQAKGLPEQTQESLESHPSGEQETAEHHSEPPSEPQQVSQHMYVE
ALAPVQHVEPETCCEALESQTVAAVPVAAVPVAADTLSSELVDQADAQPVLQEAMEARSDRGENAEWEIDSSPYE
SSCDSSSSDSSDSENEGYQLLGLEETARLLMEAEAGSDDETDPSKGGKLPTVRAARVRTKNEVAEAPPPRPDVVI
TPEMGIEELGVVVHIVEGVVVIKAVTPGEYQVLDTGSVLCTANRTVVGVVAETIGTVIQPMYTVRFAAESSDNDD
DLVSALGLQVGTKLFYPVDLASYVFTQPLRNVKGSDASNMHDEEVGDDDLDFSDDEKEAEYKRSVKQQRSKNKSA
KPDASRPPHPLRQQTSADAGLNYDDADVKASNDADEDGPYRPLARPPGFGTQSPSADFVEPAPRFGAHRGSQRRD
NQRGRGAKGRAVNRGSSSSRNASSNPLPREHVAPSLQSLQHPPQPQHALPNYPFLPAYSAQQAAATPLPQPLPPQ
LHGASLPNLGDIFIPPPRHPSLPHGAPVPPPPPLLPRQMGWAAPTQTPAPPSNGGTFLNPSLIAALMSQIQAGTG
QQWSPQQQPPPGYGR*
Coding >OphauG2|4370
ATGATTGACCACCAGCCCCCGAGCCCTGCCTCGATAACCTTTGCCTTGGAAGCGGCACTGGGAGGATTACCCGAT
GCCATCTCGACACAAGATCAGGCCAAGGGGCTTCCAGAACAGACACAAGAATCGCTCGAGTCACATCCGTCAGGC
GAGCAAGAGACAGCAGAGCACCATTCAGAGCCGCCATCAGAGCCACAACAAGTCTCGCAGCACATGTACGTTGAG
GCCCTGGCCCCAGTGCAACATGTTGAACCAGAAACGTGCTGCGAGGCTCTAGAATCTCAAACAGTTGCAGCTGTC
CCAGTTGCAGCTGTCCCAGTTGCAGCAGATACGCTGTCATCAGAGCTTGTAGACCAGGCAGACGCCCAGCCAGTA
TTACAAGAGGCCATGGAGGCTCGAAGCGACAGGGGCGAAAATGCAGAGTGGGAAATAGACTCATCGCCATACGAA
TCTTCATGCGACTCGAGTAGCTCCGACTCGTCAGACTCAGAGAATGAAGGCTATCAGCTCCTCGGCCTTGAAGAA
ACAGCCCGCCTGCTCATGGAGGCCGAGGCCGGCTCCGACGACGAGACGGACCCGTCCAAGGGCGGCAAACTCCCC
ACTGTCCGCGCCGCCCGAGTGCGCACCAAGAACGAAGTTGCTGAAGCCCCCCCACCGCGCCCCGACGTGGTCATC
ACGCCCGAGATGGGCATTGAGGAGCTCGGTGTCGTGGTGCACATTGTGGAAGGCGTCGTGGTCATCAAGGCCGTC
ACACCAGGAGAGTACCAGGTGCTCGACACAGGCTCCGTCCTCTGCACCGCCAACCGCACCGTGGTGGGCGTCGTG
GCGGAAACGATTGGCACCGTGATCCAGCCCATGTACACGGTCCGCTTTGCTGCTGAGAGCAGCGACAATGACGAC
GACTTGGTGTCGGCGCTCGGCCTGCAAGTCGGCACAAAGCTCTTTTACCCCGTCGACCTTGCCTCGTATGTCTTT
ACGCAGCCCTTGCGCAACGTCAAGGGCTCGGATGCGAGTAACATGCACGACGAGGAGGTTGGCGACGACGATTTG
GACTTTTCCGACGACGAAAAGGAGGCAGAGTATAAACGTTCGGTCAAGCAGCAAAGGAGCAAGAACAAGAGCGCA
AAGCCTGATGCCTCGCGTCCACCCCATCCGCTTCGACAGCAGACGAGTGCCGATGCAGGCCTCAACTACGACGAC
GCCGACGTCAAGGCCTCCAACGACGCCGATGAGGACGGGCCATACCGTCCCTTGGCTCGGCCTCCCGGTTTCGGC
ACCCAAAGCCCCTCAGCAGACTTTGTCGAGCCAGCTCCTCGCTTTGGCGCCCACCGCGGCAGCCAGCGCAGAGAC
AACCAACGCGGCAGAGGCGCAAAGGGCCGCGCCGTCAATAGAGGCAGCAGCAGTAGCCGCAACGCCTCGTCCAAC
CCTCTGCCCCGAGAGCACGTCGCCCCTAGTCTCCAAAGCCTTCAACATCCCCCACAGCCACAACACGCGCTCCCA
AATTACCCCTTCCTGCCCGCCTATTCTGCCCAACAAGCCGCCGCCACTCCTCTTCCTCAACCACTGCCTCCTCAG
CTTCACGGCGCCTCGTTGCCGAACCTGGGCGACATTTTTATCCCTCCTCCCCGGCATCCGTCCCTCCCTCACGGC
GCGCCCGTGCCGCCACCGCCGCCGCTGCTGCCTCGGCAAATGGGCTGGGCCGCTCCCACGCAAACACCAGCTCCC
CCATCCAATGGAGGCACCTTTCTCAATCCTTCCCTCATTGCGGCCCTTATGAGTCAGATCCAGGCTGGAACTGGC
CAGCAATGGAGTCCGCAGCAGCAGCCCCCACCTGGTTATGGGCGGTAG
Transcript >OphauG2|4370
ATGATTGACCACCAGCCCCCGAGCCCTGCCTCGATAACCTTTGCCTTGGAAGCGGCACTGGGAGGATTACCCGAT
GCCATCTCGACACAAGATCAGGCCAAGGGGCTTCCAGAACAGACACAAGAATCGCTCGAGTCACATCCGTCAGGC
GAGCAAGAGACAGCAGAGCACCATTCAGAGCCGCCATCAGAGCCACAACAAGTCTCGCAGCACATGTACGTTGAG
GCCCTGGCCCCAGTGCAACATGTTGAACCAGAAACGTGCTGCGAGGCTCTAGAATCTCAAACAGTTGCAGCTGTC
CCAGTTGCAGCTGTCCCAGTTGCAGCAGATACGCTGTCATCAGAGCTTGTAGACCAGGCAGACGCCCAGCCAGTA
TTACAAGAGGCCATGGAGGCTCGAAGCGACAGGGGCGAAAATGCAGAGTGGGAAATAGACTCATCGCCATACGAA
TCTTCATGCGACTCGAGTAGCTCCGACTCGTCAGACTCAGAGAATGAAGGCTATCAGCTCCTCGGCCTTGAAGAA
ACAGCCCGCCTGCTCATGGAGGCCGAGGCCGGCTCCGACGACGAGACGGACCCGTCCAAGGGCGGCAAACTCCCC
ACTGTCCGCGCCGCCCGAGTGCGCACCAAGAACGAAGTTGCTGAAGCCCCCCCACCGCGCCCCGACGTGGTCATC
ACGCCCGAGATGGGCATTGAGGAGCTCGGTGTCGTGGTGCACATTGTGGAAGGCGTCGTGGTCATCAAGGCCGTC
ACACCAGGAGAGTACCAGGTGCTCGACACAGGCTCCGTCCTCTGCACCGCCAACCGCACCGTGGTGGGCGTCGTG
GCGGAAACGATTGGCACCGTGATCCAGCCCATGTACACGGTCCGCTTTGCTGCTGAGAGCAGCGACAATGACGAC
GACTTGGTGTCGGCGCTCGGCCTGCAAGTCGGCACAAAGCTCTTTTACCCCGTCGACCTTGCCTCGTATGTCTTT
ACGCAGCCCTTGCGCAACGTCAAGGGCTCGGATGCGAGTAACATGCACGACGAGGAGGTTGGCGACGACGATTTG
GACTTTTCCGACGACGAAAAGGAGGCAGAGTATAAACGTTCGGTCAAGCAGCAAAGGAGCAAGAACAAGAGCGCA
AAGCCTGATGCCTCGCGTCCACCCCATCCGCTTCGACAGCAGACGAGTGCCGATGCAGGCCTCAACTACGACGAC
GCCGACGTCAAGGCCTCCAACGACGCCGATGAGGACGGGCCATACCGTCCCTTGGCTCGGCCTCCCGGTTTCGGC
ACCCAAAGCCCCTCAGCAGACTTTGTCGAGCCAGCTCCTCGCTTTGGCGCCCACCGCGGCAGCCAGCGCAGAGAC
AACCAACGCGGCAGAGGCGCAAAGGGCCGCGCCGTCAATAGAGGCAGCAGCAGTAGCCGCAACGCCTCGTCCAAC
CCTCTGCCCCGAGAGCACGTCGCCCCTAGTCTCCAAAGCCTTCAACATCCCCCACAGCCACAACACGCGCTCCCA
AATTACCCCTTCCTGCCCGCCTATTCTGCCCAACAAGCCGCCGCCACTCCTCTTCCTCAACCACTGCCTCCTCAG
CTTCACGGCGCCTCGTTGCCGAACCTGGGCGACATTTTTATCCCTCCTCCCCGGCATCCGTCCCTCCCTCACGGC
GCGCCCGTGCCGCCACCGCCGCCGCTGCTGCCTCGGCAAATGGGCTGGGCCGCTCCCACGCAAACACCAGCTCCC
CCATCCAATGGAGGCACCTTTCTCAATCCTTCCCTCATTGCGGCCCTTATGAGTCAGATCCAGGCTGGAACTGGC
CAGCAATGGAGTCCGCAGCAGCAGCCCCCACCTGGTTATGGGCGGTAG
Gene >OphauG2|4370
ATGATTGACCACCAGCCCCCGAGCCCTGCCTCGATAACCTTTGCCTTGGAAGCGGCACTGGGAGGATTACCCGAT
GCCATCTCGACACAAGATCAGGCCAAGGGGCTTCCAGAACAGACACAAGAATCGCTCGAGTCACATCCGTCAGGC
GAGCAAGAGACAGCAGAGCACCATTCAGAGCCGCCATCAGAGCCACAACAAGTCTCGCAGCACATGTACGTTGAG
GCCCTGGCCCCAGTGCAACATGTTGAACCAGAAACGTGCTGCGAGGCTCTAGAATCTCAAACAGTTGCAGCTGTC
CCAGTTGCAGCTGTCCCAGTTGCAGCAGATACGCTGTCATCAGAGCTTGTAGACCAGGCAGACGCCCAGCCAGTA
TTACAAGAGGCCATGGAGGCTCGAAGCGACAGGGGCGAAAATGCAGAGTGGGAAATAGACTCATCGCCATACGAA
TCTTCATGCGACTCGAGTAGCTCCGACTCGTCAGACTCAGAGAATGAAGGCTATCAGCTCCTCGGCCTTGAAGAA
ACAGCCCGCCTGCTCATGGAGGCCGAGGCCGGCTCCGACGACGAGACGGACCCGTCCAAGGGCGGCAAACTCCCC
ACTGTCCGCGCCGCCCGAGTGCGCACCAAGAACGAAGTTGCTGAAGCCCCCCCACCGCGCCCCGACGTGGTCATC
ACGCCCGAGATGGGCATTGAGGAGCTCGGTGTCGTGGTGCACATTGTGGAAGGCGTCGTGGTCATCAAGGCCGTC
ACACCAGGAGAGTACCAGGTGCTCGACACAGGCTCCGTCCTCTGCACCGCCAACCGCACCGTGGTGGGCGTCGTG
GCGGAAACGATTGGCACCGTGATCCAGCCCATGTACACGGTCCGCTTTGCTGCTGAGAGCAGCGACAATGACGAC
GACTTGGTGTCGGCGCTCGGCCTGCAAGTCGGCACAAAGCTCTTTTACCCCGTCGACCTTGCCTCGTATGTCTTT
ACGCAGCCCTTGCGCAACGTCAAGGGCTCGGATGCGAGTAACATGCACGACGAGGAGGTTGGCGACGACGATTTG
GACTTTTCCGACGACGAAAAGGAGGCAGAGTATAAACGTTCGGTCAAGCAGCAAAGGAGCAAGAACAAGAGCGCA
AAGCCTGATGCCTCGCGTCCACCCCATCCGCTTCGACAGCAGACGAGTGCCGATGCAGGCCTCAACTACGACGAC
GCCGACGTCAAGGCCTCCAACGACGCCGATGAGGACGGGCCATACCGTCCCTTGGCTCGGCCTCCCGGTTTCGGC
ACCCAAAGCCCCTCAGCAGACTTTGTCGAGCCAGCTCCTCGCTTTGGCGCCCACCGCGGCAGCCAGCGCAGAGAC
AACCAACGCGGCAGAGGCGCAAAGGGCCGCGCCGTCAATAGAGGCAGCAGCAGTAGCCGCAACGCCTCGTCCAAC
CCTCTGCCCCGAGAGCACGTCGCCCCTAGTCTCCAAAGCCTTCAACATCCCCCACAGCCACAACACGCGCTCCCA
AATTACCCCTTCCTGCCCGCCTATTCTGCCCAACAAGCCGCCGCCACTCCTCTTCCTCAACCACTGCCTCCTCAG
CTTCACGGCGCCTCGTTGCCGAACCTGGGCGACATTTTTATCCCTCCTCCCCGGCATCCGTCCCTCCCTCACGGC
GCGCCCGTGCCGCCACCGCCGCCGCTGCTGCCTCGGCAAATGGGCTGGGCCGCTCCCACGCAAACACCAGCTCCC
CCATCCAATGGAGGCACCTTTCTCAATCCTTCCCTCATTGCGGCCCTTATGAGTCAGATCCAGGCTGGAACTGGC
CAGCAATGGAGTCCGCAGCAGCAGCCCCCACCTGGTTATGGGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail