Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|437
Gene name
LocationContig_11:25307..26984
Strand+
Gene length (bp)1677
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 8.2E-25 250 437
PF02225 PA PA domain 1.2E-10 147 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P96264|LPQL_MYCTU Probable lipoprotein aminopeptidase LpqL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpqL PE=1 SV=1 28 407 1.0E-41
sp|A7UI09|LAP2_TRIEQ Leucine aminopeptidase 2 OS=Trichophyton equinum GN=LAP2 PE=3 SV=1 57 461 1.0E-34
sp|A7UI10|LAP2_TRITO Leucine aminopeptidase 2 OS=Trichophyton tonsurans GN=LAP2 PE=3 SV=1 57 461 1.0E-34
sp|Q9HZQ8|LAP_PSEAE Aminopeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lap PE=1 SV=1 39 451 1.0E-34
sp|Q02PA2|LAP_PSEAB Aminopeptidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lap PE=1 SV=1 39 451 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P96264|LPQL_MYCTU Probable lipoprotein aminopeptidase LpqL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpqL PE=1 SV=1 28 407 1.0E-41
sp|A7UI09|LAP2_TRIEQ Leucine aminopeptidase 2 OS=Trichophyton equinum GN=LAP2 PE=3 SV=1 57 461 1.0E-34
sp|A7UI10|LAP2_TRITO Leucine aminopeptidase 2 OS=Trichophyton tonsurans GN=LAP2 PE=3 SV=1 57 461 1.0E-34
sp|Q9HZQ8|LAP_PSEAE Aminopeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lap PE=1 SV=1 39 451 1.0E-34
sp|Q02PA2|LAP_PSEAB Aminopeptidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lap PE=1 SV=1 39 451 1.0E-34
sp|D4D3D1|LAP2_TRIVH Probable leucine aminopeptidase 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=LAP2 PE=3 SV=1 57 482 1.0E-33
sp|Q5QHG6|LAP2_TRIRU Leucine aminopeptidase 2 OS=Trichophyton rubrum GN=LAP2 PE=1 SV=1 156 443 2.0E-32
sp|P37302|APE3_YEAST Aminopeptidase Y OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE3 PE=1 SV=1 158 471 2.0E-32
sp|D4AWC9|LAP2_ARTBC Probable leucine aminopeptidase 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=LAP2 PE=1 SV=1 156 443 3.0E-32
sp|Q2ULM2|LAP2_ASPOR probable leucine aminopeptidase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lap2 PE=1 SV=1 156 454 7.0E-32
sp|C5FTZ6|LAP2_ARTOC Leucine aminopeptidase 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LAP2 PE=3 SV=1 72 443 3.0E-31
sp|Q4WFX9|LAP2_ASPFU Probable leucine aminopeptidase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lap2 PE=3 SV=2 157 454 2.0E-28
sp|P80561|APX_STRGG Aminopeptidase S OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_5809 PE=1 SV=2 248 452 4.0E-21
sp|P81715|LIE1_STREX Leupeptin-inactivating enzyme 1 OS=Streptomyces exfoliatus GN=lieA PE=1 SV=2 248 465 3.0E-20
sp|P25152|BSAP_BACSU Aminopeptidase YwaD OS=Bacillus subtilis (strain 168) GN=ywaD PE=1 SV=2 155 439 3.0E-19
sp|P83913|LIE2_STREX Leupeptin-inactivating enzyme 2 OS=Streptomyces exfoliatus GN=lieB PE=3 SV=1 155 467 6.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|437
MNIKSWVAALCAFLLVNVTIAQFSSLQPHAAVWACRWRNVNNWVLDLERIFVDRGTRSSGTNGYRWALGYVKRRV
TGSWEAKRWLDWQEQHFKHIYDFSREVWLTSPIGENITVQTLKYNTASNIHGIEGVLIDTRTNTTHGSACLKEQW
EGIQAKGKIAIIMRGGCPLAQKVKHARDHGAIAAIIYHHVEDNTGVPGGSLGLENAGHLIPTLLTDYQSGMELNF
CVRKGIQCKVRLVVDCVTETRQGTNFIVETKVGDPKSVILVGAHLDTLPLSPGMNDNGSGVAALIEIARAMREYY
GFVNKVRFAFWGGYFNGRAGSEHYVSLLAEAHLDWHKFYLDIDMVGAIRPVWTVYSDTRDHKAGSRHMFKFLEIN
GAKPAYRHFRDSSDYVTFLKRGIPSAGLYTGSGPSIYPCHGLPCDNKRNVNSDTVFEATKAAMYMVSKLALDSSE
VPPRVKPFLRSAVVNGTEPRFYGNDTVPQDSEEDRMEYLDRIEGIASF*
Coding >OphauG2|437
ATGAATATAAAGTCTTGGGTAGCGGCACTGTGTGCCTTTCTCCTGGTCAACGTCACGATTGCGCAGTTTAGTTCT
CTGCAGCCACACGCTGCAGTATGGGCATGCCGATGGAGAAACGTCAACAATTGGGTCCTGGATCTTGAACGAATC
TTTGTCGATCGCGGCACTCGGTCCTCTGGCACAAATGGATACAGATGGGCGCTCGGCTATGTCAAGAGGCGAGTA
ACGGGCTCGTGGGAAGCGAAACGCTGGCTCGATTGGCAAGAGCAGCATTTCAAACACATCTACGACTTTTCCAGA
GAAGTGTGGCTTACCAGCCCCATTGGCGAAAACATCACGGTACAGACCCTCAAGTACAATACGGCAAGCAATATT
CACGGCATTGAGGGCGTTTTGATCGATACAAGGACCAACACCACTCATGGCTCTGCCTGTCTTAAGGAACAATGG
GAAGGGATTCAGGCCAAGGGCAAAATCGCCATCATCATGCGTGGTGGCTGTCCCCTTGCGCAAAAGGTGAAGCAC
GCTCGGGACCATGGCGCTATTGCAGCCATCATCTATCACCACGTCGAGGACAATACTGGAGTCCCTGGAGGGTCT
CTTGGCCTCGAAAATGCTGGTCATCTTATCCCAACGCTGCTCACCGACTACCAATCGGGAATGGAGCTCAATTTT
TGCGTCAGAAAGGGCATTCAATGCAAAGTCCGCCTGGTCGTTGACTGCGTCACCGAGACACGCCAGGGCACCAAT
TTCATTGTCGAGACCAAGGTCGGAGACCCCAAATCCGTCATTCTTGTTGGTGCCCATCTGGATACCCTTCCCCTC
TCGCCCGGCATGAACGACAATGGCAGTGGCGTTGCCGCCCTCATTGAGATTGCTCGTGCCATGAGGGAGTACTAC
GGCTTCGTCAACAAGGTCCGCTTTGCCTTTTGGGGTGGCTACTTTAATGGCAGGGCTGGGTCTGAGCATTATGTC
AGTCTTCTCGCAGAAGCACATCTCGATTGGCATAAATTCTACTTGGACATCGACATGGTTGGCGCCATCCGTCCC
GTGTGGACCGTGTATTCCGACACGAGAGACCACAAGGCCGGCTCCAGGCATATGTTCAAGTTTCTTGAAATAAAC
GGTGCCAAGCCAGCATACAGGCATTTCCGAGACTCGTCCGACTACGTGACGTTTCTCAAGCGAGGGATTCCCAGC
GCTGGTCTCTATACCGGTTCCGGACCCTCGATATACCCTTGTCACGGCCTCCCGTGCGATAACAAGAGAAATGTC
AACTCGGATACGGTGTTTGAGGCCACAAAGGCAGCCATGTACATGGTGTCCAAGCTGGCGCTTGACTCGTCCGAG
GTTCCTCCCCGCGTCAAGCCTTTTTTGAGATCGGCTGTGGTTAATGGCACCGAACCCAGGTTTTATGGCAACGAC
ACGGTGCCTCAGGATTCGGAGGAAGATCGCATGGAATACCTTGATCGGATTGAAGGTATCGCGTCATTTTAA
Transcript >OphauG2|437
ATGAATATAAAGTCTTGGGTAGCGGCACTGTGTGCCTTTCTCCTGGTCAACGTCACGATTGCGCAGTTTAGTTCT
CTGCAGCCACACGCTGCAGTATGGGCATGCCGATGGAGAAACGTCAACAATTGGGTCCTGGATCTTGAACGAATC
TTTGTCGATCGCGGCACTCGGTCCTCTGGCACAAATGGATACAGATGGGCGCTCGGCTATGTCAAGAGGCGAGTA
ACGGGCTCGTGGGAAGCGAAACGCTGGCTCGATTGGCAAGAGCAGCATTTCAAACACATCTACGACTTTTCCAGA
GAAGTGTGGCTTACCAGCCCCATTGGCGAAAACATCACGGTACAGACCCTCAAGTACAATACGGCAAGCAATATT
CACGGCATTGAGGGCGTTTTGATCGATACAAGGACCAACACCACTCATGGCTCTGCCTGTCTTAAGGAACAATGG
GAAGGGATTCAGGCCAAGGGCAAAATCGCCATCATCATGCGTGGTGGCTGTCCCCTTGCGCAAAAGGTGAAGCAC
GCTCGGGACCATGGCGCTATTGCAGCCATCATCTATCACCACGTCGAGGACAATACTGGAGTCCCTGGAGGGTCT
CTTGGCCTCGAAAATGCTGGTCATCTTATCCCAACGCTGCTCACCGACTACCAATCGGGAATGGAGCTCAATTTT
TGCGTCAGAAAGGGCATTCAATGCAAAGTCCGCCTGGTCGTTGACTGCGTCACCGAGACACGCCAGGGCACCAAT
TTCATTGTCGAGACCAAGGTCGGAGACCCCAAATCCGTCATTCTTGTTGGTGCCCATCTGGATACCCTTCCCCTC
TCGCCCGGCATGAACGACAATGGCAGTGGCGTTGCCGCCCTCATTGAGATTGCTCGTGCCATGAGGGAGTACTAC
GGCTTCGTCAACAAGGTCCGCTTTGCCTTTTGGGGTGGCTACTTTAATGGCAGGGCTGGGTCTGAGCATTATGTC
AGTCTTCTCGCAGAAGCACATCTCGATTGGCATAAATTCTACTTGGACATCGACATGGTTGGCGCCATCCGTCCC
GTGTGGACCGTGTATTCCGACACGAGAGACCACAAGGCCGGCTCCAGGCATATGTTCAAGTTTCTTGAAATAAAC
GGTGCCAAGCCAGCATACAGGCATTTCCGAGACTCGTCCGACTACGTGACGTTTCTCAAGCGAGGGATTCCCAGC
GCTGGTCTCTATACCGGTTCCGGACCCTCGATATACCCTTGTCACGGCCTCCCGTGCGATAACAAGAGAAATGTC
AACTCGGATACGGTGTTTGAGGCCACAAAGGCAGCCATGTACATGGTGTCCAAGCTGGCGCTTGACTCGTCCGAG
GTTCCTCCCCGCGTCAAGCCTTTTTTGAGATCGGCTGTGGTTAATGGCACCGAACCCAGGTTTTATGGCAACGAC
ACGGTGCCTCAGGATTCGGAGGAAGATCGCATGGAATACCTTGATCGGATTGAAGGTATCGCGTCATTTTAA
Gene >OphauG2|437
ATGAATATAAAGTCTTGGGTAGCGGCACTGTGTGCCTTTCTCCTGGTCAACGTCACGATTGCGCAGTTTAGTTCT
CTGCAGCCACACGCTGCAGTATGGGCATGCCGATGGAGAAAGTCAGCCATGCCTCATCTACATCATGACGATGAA
GCCGAGCTTTTACTGACATTGTATCCACAGCGTCAACAATTGGGTCCTGGATCTTGAACGAATCTTTGTCGATCG
CGGCACTCGGTCCTCTGGCACAAATGGATACAGATGGGCGCTCGGCTATGTCAAGAGGCGAGTAACGGGCTCGTG
GGAAGCGAAACGCTGGCTCGATTGGCAAGAGCAGCATTTCAAACACATCTACGACTTTTCCAGAGAAGTGTGGCT
TACCAGCCCCATTGGCGAAAACATCACGGTACAGACCCTCAAGTACAATACGGCAAGCAATATTCACGGCATTGA
GGGCGTTTTGATCGATACAAGGACCAACACCACTCATGGCTCTGCCTGTCTTAAGGAACAATGGGAAGGGATTCA
GGCCAAGGGCAAAATCGCCATCATCATGCGTGGTGGCTGTCCCCTTGCGCAAAAGGTGAAGCACGCTCGGGACCA
TGGCGCTATTGCAGCCATCATCTATCACCACGTCGAGGACAATACTGGAGTCCCTGGAGGGTCTCTTGGCCTCGA
AAATGCTGGTCATCTTATCCCAACGCTGCTCACCGACTACCAATCGGGAATGGAGCTCAATTTTTGCGTCAGAAA
GGGCATTCAATGCAAAGTCCGCCTGGTCGTTGACTGCGTCACCGAGACACGCCAGGGCACCAATTTCATTGTCGA
GACCAAGGTCGGAGACCCCAAATCCGTCATTCTTGTTGGTGCCCATCTGGATACCCTTCCCCTCTCGCCCGGCAT
GAACGACAATGGCAGTGGCGTTGCCGCCCTCATTGAGATTGCTCGTGCCATGAGGGAGTACTACGGCTTCGTCAA
CAAGGTCCGCTTTGCCTTTTGGGGTGGCTACTTGTGAGTCTGCCTTGTCTGGAGCCACTCACGAATGACTCGACT
AACGCAACGCAGTAATGGCAGGGCTGGGTCTGAGCATTATGTCAGTCTTCTCGCAGAAGCACATCTCGATTGGCA
TAAATTCTACTTGGACATCGACATGGTTGGCGCCATCCGTCCCGTGTGGACCGTGTATTCCGACACGAGAGACCA
CAAGGCCGGCTCCAGGCATATGTTCAAGTTTCTTGAAATAAACGGTGCCAAGCCAGCATACAGGTGAGAAGCGCT
ACTCACTTTGCTCCTGATGCGGGACGCAGCGACTGACCAACGCATTGTAGGCATTTCCGAGACTCGTCCGACTAC
GTGACGTTTCTCAAGCGAGGGATTCCCAGCGCTGGTCTCTATACCGGTTCCGGACCCTCGATATACCCTTGTCAC
GGCCTCCCGTGCGATAACAAGAGAAATGTCAACTCGGATACGGTGTTTGAGGCCACAAAGGCAGCCATGTACATG
GTGTCCAAGCTGGCGCTTGACTCGTCCGAGGTTCCTCCCCGCGTCAAGCCTTTTTTGAGATCGGCTGTGGTTAAT
GGCACCGAACCCAGGTTTTATGGCAACGACACGGTGCCTCAGGATTCGGAGGAAGATCGCATGGAATACCTTGAT
CGGATTGAAGGTATCGCGTCATTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail