© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|4359 |
| Gene name | |
| Location | Contig_360:7147..7960 |
| Strand | + |
| Gene length (bp) | 813 |
| Transcript length (bp) | 612 |
| Coding sequence length (bp) | 612 |
| Protein length (aa) | 204 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF04442 | CtaG_Cox11 | Cytochrome c oxidase assembly protein CtaG/Cox11 | 1.1E-59 | 33 | 188 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P19516|COX11_YEAST | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX11 PE=3 SV=2 | 1 | 191 | 4.0E-72 |
| sp|Q86ZU7|CO112_SCHPO | Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1102 PE=1 SV=2 | 2 | 195 | 3.0E-63 |
| sp|Q9UTM2|CO111_SCHPO | Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1101 PE=1 SV=2 | 2 | 195 | 4.0E-63 |
| sp|Q6P8I6|COX11_MOUSE | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Mus musculus GN=Cox11 PE=1 SV=1 | 6 | 190 | 5.0E-60 |
| sp|A3KMZ6|COX11_BOVIN | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Bos taurus GN=COX11 PE=2 SV=1 | 6 | 190 | 8.0E-59 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P19516|COX11_YEAST | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX11 PE=3 SV=2 | 1 | 191 | 4.0E-72 |
| sp|Q86ZU7|CO112_SCHPO | Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1102 PE=1 SV=2 | 2 | 195 | 3.0E-63 |
| sp|Q9UTM2|CO111_SCHPO | Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1101 PE=1 SV=2 | 2 | 195 | 4.0E-63 |
| sp|Q6P8I6|COX11_MOUSE | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Mus musculus GN=Cox11 PE=1 SV=1 | 6 | 190 | 5.0E-60 |
| sp|A3KMZ6|COX11_BOVIN | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Bos taurus GN=COX11 PE=2 SV=1 | 6 | 190 | 8.0E-59 |
| sp|Q8GWR0|COX11_ARATH | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Arabidopsis thaliana GN=COX11 PE=2 SV=1 | 11 | 188 | 3.0E-58 |
| sp|Q54HM6|COX11_DICDI | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Dictyostelium discoideum GN=cox11 PE=3 SV=1 | 2 | 189 | 1.0E-57 |
| sp|Q9Y6N1|COX11_HUMAN | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Homo sapiens GN=COX11 PE=1 SV=3 | 10 | 190 | 8.0E-57 |
| sp|O21243|COXZ_RECAM | Cytochrome c oxidase assembly protein ctaG OS=Reclinomonas americana GN=CTAG PE=3 SV=1 | 10 | 190 | 3.0E-56 |
| sp|Q5R7U6|COX11_PONAB | Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Pongo abelii GN=COX11 PE=3 SV=2 | 5 | 190 | 4.0E-56 |
| sp|Q1RJ56|COXZ_RICBR | Cytochrome c oxidase assembly protein CtaG OS=Rickettsia bellii (strain RML369-C) GN=ctaG PE=3 SV=1 | 10 | 190 | 6.0E-54 |
| sp|Q92IL2|COXZ_RICCN | Cytochrome c oxidase assembly protein CtaG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ctaG PE=3 SV=1 | 10 | 190 | 2.0E-52 |
| sp|Q9ZDM3|COXZ_RICPR | Cytochrome c oxidase assembly protein CtaG OS=Rickettsia prowazekii (strain Madrid E) GN=ctaG PE=3 SV=1 | 10 | 190 | 2.0E-52 |
| sp|Q4UM75|COXZ_RICFE | Cytochrome c oxidase assembly protein CtaG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ctaG PE=3 SV=1 | 10 | 190 | 8.0E-51 |
| sp|Q985W8|COXZ_RHILO | Cytochrome c oxidase assembly protein CtaG OS=Rhizobium loti (strain MAFF303099) GN=ctaG PE=3 SV=1 | 12 | 187 | 6.0E-45 |
| sp|A6WWG2|COXZ_OCHA4 | Cytochrome c oxidase assembly protein CtaG OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ctaG PE=3 SV=1 | 2 | 187 | 5.0E-44 |
| sp|Q92RG6|COXZ_RHIME | Cytochrome c oxidase assembly protein CtaG OS=Rhizobium meliloti (strain 1021) GN=ctaG PE=1 SV=1 | 6 | 187 | 1.0E-43 |
| sp|B0CKF6|COXZ_BRUSI | Cytochrome c oxidase assembly protein CtaG OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ctaG PE=3 SV=1 | 10 | 187 | 4.0E-43 |
| sp|Q8YFQ7|COXZ_BRUME | Cytochrome c oxidase assembly protein CtaG OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ctaG PE=3 SV=2 | 10 | 187 | 4.0E-43 |
| sp|C0RHH8|COXZ_BRUMB | Cytochrome c oxidase assembly protein CtaG OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ctaG PE=3 SV=1 | 10 | 187 | 4.0E-43 |
| sp|A6U6U8|COXZ_SINMW | Cytochrome c oxidase assembly protein CtaG OS=Sinorhizobium medicae (strain WSM419) GN=ctaG PE=3 SV=1 | 6 | 187 | 4.0E-43 |
| sp|Q8G261|COXZ_BRUSU | Cytochrome c oxidase assembly protein CtaG OS=Brucella suis biovar 1 (strain 1330) GN=ctaG PE=3 SV=1 | 10 | 187 | 4.0E-43 |
| sp|A9M8Z5|COXZ_BRUC2 | Cytochrome c oxidase assembly protein CtaG OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ctaG PE=3 SV=1 | 10 | 187 | 4.0E-43 |
| sp|A5VP42|COXZ_BRUO2 | Cytochrome c oxidase assembly protein CtaG OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ctaG PE=3 SV=1 | 10 | 187 | 6.0E-43 |
| sp|B3PSB4|COXZ_RHIE6 | Cytochrome c oxidase assembly protein CtaG OS=Rhizobium etli (strain CIAT 652) GN=ctaG PE=3 SV=1 | 4 | 187 | 2.0E-42 |
| sp|B5ZSV4|COXZ_RHILW | Cytochrome c oxidase assembly protein CtaG OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ctaG PE=3 SV=1 | 10 | 187 | 3.0E-42 |
| sp|Q1MKI3|COXZ_RHIL3 | Cytochrome c oxidase assembly protein CtaG OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ctaG PE=3 SV=1 | 7 | 187 | 3.0E-42 |
| sp|Q167V9|COXZ_ROSDO | Cytochrome c oxidase assembly protein CtaG OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ctaG PE=3 SV=1 | 19 | 188 | 1.0E-41 |
| sp|Q2KBM0|COXZ_RHIEC | Cytochrome c oxidase assembly protein CtaG OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ctaG PE=3 SV=1 | 4 | 187 | 4.0E-41 |
| sp|C3MHJ5|COXZ_RHISN | Cytochrome c oxidase assembly protein CtaG OS=Rhizobium sp. (strain NGR234) GN=ctaG PE=3 SV=1 | 9 | 187 | 9.0E-40 |
| sp|Q5LNX9|COXZ_RUEPO | Cytochrome c oxidase assembly protein CtaG OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ctaG PE=3 SV=1 | 28 | 188 | 2.0E-39 |
| sp|A7IPB8|COXZ_XANP2 | Cytochrome c oxidase assembly protein CtaG OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ctaG PE=3 SV=1 | 27 | 199 | 1.0E-38 |
| sp|Q11KD0|COXZ_CHESB | Cytochrome c oxidase assembly protein CtaG OS=Chelativorans sp. (strain BNC1) GN=ctaG PE=3 SV=1 | 5 | 187 | 2.0E-37 |
| sp|A1BA38|COXZ_PARDP | Cytochrome c oxidase assembly protein CtaG OS=Paracoccus denitrificans (strain Pd 1222) GN=ctaG PE=3 SV=1 | 19 | 188 | 2.0E-37 |
| sp|A4WQ59|COXZ_RHOS5 | Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ctaG PE=3 SV=1 | 30 | 188 | 3.0E-37 |
| sp|Q5HA73|COXZ_EHRRW | Cytochrome c oxidase assembly protein CtaG OS=Ehrlichia ruminantium (strain Welgevonden) GN=ctaG PE=3 SV=1 | 31 | 190 | 2.0E-36 |
| sp|Q1GE51|COXZ_RUEST | Cytochrome c oxidase assembly protein CtaG OS=Ruegeria sp. (strain TM1040) GN=ctaG PE=3 SV=1 | 28 | 188 | 3.0E-36 |
| sp|P56940|COXZ_RHOSH | Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides GN=ctaG PE=1 SV=1 | 20 | 188 | 3.0E-36 |
| sp|Q3J5F7|COXZ_RHOS4 | Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ctaG PE=3 SV=1 | 20 | 188 | 3.0E-36 |
| sp|A3PGX7|COXZ_RHOS1 | Cytochrome c oxidase assembly protein CtaG OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ctaG PE=3 SV=1 | 20 | 188 | 6.0E-36 |
| sp|P08303|COXZ_PARDE | Cytochrome c oxidase assembly protein CtaG OS=Paracoccus denitrificans GN=ctaG PE=3 SV=1 | 19 | 188 | 7.0E-36 |
| sp|Q5FGG9|COXZ_EHRRG | Cytochrome c oxidase assembly protein CtaG OS=Ehrlichia ruminantium (strain Gardel) GN=ctaG PE=3 SV=1 | 31 | 190 | 7.0E-36 |
| sp|Q8UHB2|COXZ_AGRFC | Cytochrome c oxidase assembly protein CtaG OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ctaG PE=3 SV=2 | 12 | 192 | 8.0E-36 |
| sp|B3QF26|COXZ_RHOPT | Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain TIE-1) GN=ctaG PE=3 SV=1 | 27 | 190 | 6.0E-35 |
| sp|A4Z2D0|COXZ_BRASO | Cytochrome c oxidase assembly protein CtaG OS=Bradyrhizobium sp. (strain ORS278) GN=ctaG PE=3 SV=1 | 21 | 190 | 4.0E-34 |
| sp|Q2IR93|COXZ_RHOP2 | Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain HaA2) GN=ctaG PE=3 SV=1 | 5 | 190 | 6.0E-34 |
| sp|Q13CY3|COXZ_RHOPS | Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain BisB5) GN=ctaG PE=3 SV=1 | 14 | 190 | 7.0E-34 |
| sp|P56939|COXZ_BRADU | Cytochrome c oxidase assembly protein CtaG OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ctaG PE=3 SV=1 | 21 | 190 | 7.0E-33 |
| sp|Q20X23|COXZ_RHOPB | Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain BisB18) GN=ctaG PE=3 SV=1 | 11 | 190 | 2.0E-32 |
| sp|A5EAA0|COXZ_BRASB | Cytochrome c oxidase assembly protein CtaG OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ctaG PE=3 SV=1 | 21 | 190 | 3.0E-32 |
| sp|Q1QHV9|COXZ_NITHX | Cytochrome c oxidase assembly protein CtaG OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ctaG1 PE=3 SV=1 | 22 | 190 | 2.0E-31 |
| sp|Q07HB0|COXZ_RHOP5 | Cytochrome c oxidase assembly protein CtaG OS=Rhodopseudomonas palustris (strain BisA53) GN=ctaG PE=3 SV=1 | 5 | 190 | 3.0E-28 |
| sp|Q04302|COXZ_EHRRU | Cytochrome c oxidase assembly protein CtaG OS=Ehrlichia ruminantium GN=ctaG PE=3 SV=1 | 31 | 170 | 6.0E-26 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005507 | copper ion binding | Yes |
| GO:0003674 | molecular_function | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0046872 | metal ion binding | No |
| GO:0043169 | cation binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 33 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 15 | 37 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|4359 MQQARDRYNKKNQTVAYYTLSLILGTVALSYGSVPLYKMICQTTGWGGQPVRAHSGSYDDRLSSRLVPITSTNRI RVTFSASVSDELPWKFVPQQREVRVLPGETALAFYKAENRGDKDIIGVATYSVTPAQCAPYFSKIQCFCFEEQRL NAGETVDMPVFFYLDPDLLNDLNMKGVETVTLNYTFFKARYDNNGRFKAPSAI* |
| Coding | >OphauG2|4359 ATGCAGCAAGCGCGAGACCGCTACAACAAGAAGAACCAAACGGTGGCCTATTACACCTTGAGCCTGATACTCGGC ACCGTAGCGCTTTCCTACGGCTCGGTGCCCTTGTACAAAATGATATGCCAAACCACTGGCTGGGGCGGCCAGCCT GTTCGTGCTCACAGCGGCTCGTACGACGACCGTCTTTCAAGCCGCCTCGTCCCCATCACCTCTACCAACCGCATC CGTGTCACCTTCAGCGCTTCTGTTTCTGACGAGCTTCCGTGGAAGTTTGTTCCTCAGCAACGCGAGGTCCGCGTC CTGCCCGGTGAGACTGCGCTGGCATTCTACAAGGCCGAGAACCGGGGCGATAAAGATATCATTGGTGTGGCCACT TATAGCGTCACCCCCGCCCAGTGCGCTCCCTACTTCAGCAAAATACAATGCTTTTGTTTTGAAGAACAACGTCTC AATGCTGGCGAGACAGTAGACATGCCCGTCTTCTTCTACCTTGATCCTGATCTACTCAACGACCTTAATATGAAG GGTGTCGAGACCGTTACCCTTAATTACACATTCTTCAAAGCAAGGTACGACAATAACGGGCGATTCAAAGCGCCA AGCGCGATTTGA |
| Transcript | >OphauG2|4359 ATGCAGCAAGCGCGAGACCGCTACAACAAGAAGAACCAAACGGTGGCCTATTACACCTTGAGCCTGATACTCGGC ACCGTAGCGCTTTCCTACGGCTCGGTGCCCTTGTACAAAATGATATGCCAAACCACTGGCTGGGGCGGCCAGCCT GTTCGTGCTCACAGCGGCTCGTACGACGACCGTCTTTCAAGCCGCCTCGTCCCCATCACCTCTACCAACCGCATC CGTGTCACCTTCAGCGCTTCTGTTTCTGACGAGCTTCCGTGGAAGTTTGTTCCTCAGCAACGCGAGGTCCGCGTC CTGCCCGGTGAGACTGCGCTGGCATTCTACAAGGCCGAGAACCGGGGCGATAAAGATATCATTGGTGTGGCCACT TATAGCGTCACCCCCGCCCAGTGCGCTCCCTACTTCAGCAAAATACAATGCTTTTGTTTTGAAGAACAACGTCTC AATGCTGGCGAGACAGTAGACATGCCCGTCTTCTTCTACCTTGATCCTGATCTACTCAACGACCTTAATATGAAG GGTGTCGAGACCGTTACCCTTAATTACACATTCTTCAAAGCAAGGTACGACAATAACGGGCGATTCAAAGCGCCA AGCGCGATTTGA |
| Gene | >OphauG2|4359 ATGCAGCAAGCGCGAGACCGCTACAACAAGAAGAACCAAACGGTGGCGTAGGCCAATTTCGATCCCATTTCTGCT GGCCTGCGCTAATGCCATGGACAACTCCATTCTGCAGCTATTACACCTTGAGCCTGATACTCGGCACCGTAGCGC TTTCCTACGGCTCGGTGCCCTTGTACAAAATGGTGCGCCCTCGAATTCTTTTGCTGGCTATTGCTTCCTCTCCAT CTCTTATCCATTGACTGGTGATTGAATCCTGTCTTTCTAGATATGCCAAACCACTGGCTGGGGCGGCCAGCCTGT TCGTGCTCACAGCGGCTCGTACGACGACCGTCTTTCAAGCCGCCTCGTCCCCATCACCTCTACCAACCGCATCCG TGTCACCTTCAGCGCTTCTGTTTCTGACGAGCTTCCGTGGAAGTTTGTTCCTCAGCAACGCGAGGTCCGCGTCCT GCCCGGTGAGACTGCGCTGGCATTCTACAAGGCCGAGAACCGGGGCGATAAAGATATCATTGGTGTGGCCACTTA TAGCGTCACCCCCGCCCAGTGCGCTCCCTACTTCAGCAAAATACAATGCTTTTGTTTTGAAGAACAACGTCTCAA TGCTGGCGAGACAGTAGACATGCCCGTCTTCTTCTACCTTGATCCTGATCTACTCAACGACCTTAATATGAAGGG TGTCGAGACCGTTACCCTTAATTACACATTCTTCAGTCCGTTAAACTTTTCTTCACATGCCCCGACTCTGTCGCT AATGACCCTACAGAAGCAAGGTACGACAATAACGGGCGATTCAAAGCGCCAAGCGCGATTTGA |