Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4352
Gene name
LocationContig_36:37090..40442
Strand-
Gene length (bp)3352
Transcript length (bp)3096
Coding sequence length (bp)3096
Protein length (aa) 1032

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08519 RFC1 Replication factor RFC1 C terminal domain 1.7E-55 785 936
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 1.6E-13 312 387
PF00004 AAA ATPase family associated with various cellular activities (AAA) 8.8E-08 507 604

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60182|RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc1 PE=1 SV=1 297 997 0.0E+00
sp|P38630|RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC1 PE=1 SV=1 262 1006 0.0E+00
sp|P35601|RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus GN=Rfc1 PE=1 SV=2 302 944 3.0E-140
sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 302 972 2.0E-138
sp|P35600|RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster GN=Gnf1 PE=1 SV=2 304 1005 4.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60182|RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc1 PE=1 SV=1 297 997 0.0E+00
sp|P38630|RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC1 PE=1 SV=1 262 1006 0.0E+00
sp|P35601|RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus GN=Rfc1 PE=1 SV=2 302 944 3.0E-140
sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 302 972 2.0E-138
sp|P35600|RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster GN=Gnf1 PE=1 SV=2 304 1005 4.0E-118
sp|Q2R2B4|RFC1_ORYSJ Replication factor C subunit 1 OS=Oryza sativa subsp. japonica GN=RFC1 PE=2 SV=2 306 911 3.0E-90
sp|Q9C587|RFC1_ARATH Replication factor C subunit 1 OS=Arabidopsis thaliana GN=RFC1 PE=2 SV=1 306 939 6.0E-90
sp|Q54MH9|RFC1_DICDI Probable replication factor C subunit 1 OS=Dictyostelium discoideum GN=rfc1 PE=3 SV=1 455 942 8.0E-74
sp|A1RWU6|RFCL_THEPD Replication factor C large subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcL PE=3 SV=1 457 677 1.0E-23
sp|O26342|RFCL_METTH Replication factor C large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcL PE=1 SV=1 457 677 5.0E-23
sp|Q2NH88|RFCL_METST Replication factor C large subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcL PE=3 SV=1 459 676 1.0E-22
sp|Q46AT6|RFCL_METBF Replication factor C large subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcL PE=3 SV=1 459 682 4.0E-22
sp|A3MS27|RFCL_PYRCJ Replication factor C large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcL PE=3 SV=1 457 805 5.0E-22
sp|A8AC24|RFCL_IGNH4 Replication factor C large subunit OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rfcL PE=3 SV=1 459 872 1.0E-21
sp|A4FZL6|RFCL_METM5 Replication factor C large subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcL PE=3 SV=1 459 677 5.0E-21
sp|A5UMF4|RFCL_METS3 Replication factor C large subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcL PE=3 SV=1 455 677 1.0E-20
sp|Q0W3P4|RFCL_METAR Replication factor C large subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcL PE=3 SV=1 457 682 1.0E-20
sp|A6VIW1|RFCL_METM7 Replication factor C large subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcL PE=3 SV=1 459 677 2.0E-20
sp|Q58294|RFCL_METJA Replication factor C large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcL PE=1 SV=1 459 677 2.0E-20
sp|A9A6N2|RFCL_METM6 Replication factor C large subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcL PE=3 SV=1 459 677 3.0E-20
sp|Q8Q084|RFCL_METMA Replication factor C large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcL PE=3 SV=1 459 682 3.0E-20
sp|Q8TZC5|RFCL_METKA Replication factor C large subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcL PE=3 SV=1 457 677 3.0E-20
sp|A2SQR6|RFCL_METLZ Replication factor C large subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcL PE=3 SV=1 459 725 5.0E-20
sp|B1YC69|RFCL_PYRNV Replication factor C large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rfcL PE=3 SV=1 457 677 8.0E-20
sp|Q975D4|RFCL_SULTO Replication factor C large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcL PE=3 SV=2 459 751 1.0E-19
sp|Q97BC2|RFCL_THEVO Replication factor C large subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcL PE=3 SV=1 459 689 1.0E-19
sp|Q4JAB1|RFCL_SULAC Replication factor C large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcL PE=3 SV=1 459 782 1.0E-19
sp|A6URV8|RFCL_METVS Replication factor C large subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcL PE=3 SV=1 459 677 2.0E-19
sp|O29072|RFCL_ARCFU Replication factor C large subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcL PE=1 SV=1 454 677 3.0E-19
sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcL PE=3 SV=1 505 677 3.0E-19
sp|A1RSA3|RFCL_PYRIL Replication factor C large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcL PE=3 SV=1 505 806 3.0E-19
sp|A6UWR5|RFCL_META3 Replication factor C large subunit OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rfcL PE=3 SV=1 459 687 5.0E-19
sp|Q12TX1|RFCL_METBU Replication factor C large subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rfcL PE=3 SV=1 459 676 2.0E-18
sp|A3CTR4|RFCL_METMJ Replication factor C large subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcL PE=3 SV=1 459 684 2.0E-18
sp|B9LPV1|RFCL_HALLT Replication factor C large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rfcL PE=3 SV=1 457 682 2.0E-18
sp|Q6M0E9|RFCL_METMP Replication factor C large subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcL PE=3 SV=1 459 677 2.0E-18
sp|Q8ZYK3|RFCL_PYRAE Replication factor C large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcL PE=3 SV=1 505 677 4.0E-18
sp|Q2FQR4|RFCL_METHJ Replication factor C large subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcL PE=3 SV=1 459 692 5.0E-18
sp|A0B6D7|RFCL_METTP Replication factor C large subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rfcL PE=3 SV=1 459 677 6.0E-18
sp|Q3ISA5|RFCL_NATPD Replication factor C large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcL PE=3 SV=1 457 676 1.0E-17
sp|Q8TPU4|RFCL_METAC Replication factor C large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcL PE=3 SV=1 459 682 2.0E-17
sp|Q18GQ9|RFCL_HALWD Replication factor C large subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcL PE=3 SV=1 457 681 2.0E-17
sp|Q9HIP7|RFCL_THEAC Replication factor C large subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcL PE=3 SV=1 459 677 3.0E-17
sp|Q9HPI4|RFCL_HALSA Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcL PE=3 SV=2 457 687 6.0E-17
sp|B0R601|RFCL_HALS3 Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcL PE=3 SV=1 457 687 6.0E-17
sp|P49956|CTF18_YEAST Chromosome transmission fidelity protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF18 PE=1 SV=1 437 677 1.0E-16
sp|Q9USQ1|CTF18_SCHPO Chromosome transmission fidelity protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf18 PE=1 SV=1 454 697 4.0E-16
sp|A2BL93|RFCL_HYPBU Replication factor C large subunit OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rfcL PE=3 SV=1 459 751 5.0E-16
sp|A7I781|RFCL_METB6 Replication factor C large subunit OS=Methanoregula boonei (strain 6A8) GN=rfcL PE=3 SV=1 459 690 5.0E-16
sp|P60373|RFCL_NANEQ Replication factor C large subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcL PE=3 SV=1 505 681 5.0E-16
sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1 504 679 2.0E-15
sp|C3MVD2|RFCL_SULIM Replication factor C large subunit OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rfcL PE=3 SV=1 459 751 3.0E-15
sp|C3N5N1|RFCL_SULIA Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.27) GN=rfcL PE=3 SV=1 459 751 3.0E-15
sp|C3NHF4|RFCL_SULIN Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rfcL PE=3 SV=1 459 751 3.0E-15
sp|Q9YBS5|RFCL_AERPE Replication factor C large subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcL PE=3 SV=2 449 677 3.0E-15
sp|C3NE95|RFCL_SULIY Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rfcL PE=3 SV=1 459 751 6.0E-15
sp|C3MQ13|RFCL_SULIL Replication factor C large subunit OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rfcL PE=3 SV=1 459 751 6.0E-15
sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 18 homolog OS=Xenopus laevis GN=chtf18 PE=2 SV=1 508 703 6.0E-15
sp|C4KHA7|RFCL_SULIK Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rfcL PE=3 SV=1 459 751 7.0E-15
sp|Q5V1F7|RFCL_HALMA Replication factor C large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcL PE=3 SV=1 457 676 1.0E-14
sp|Q5JHP1|RFCL_THEKO Replication factor C large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcL PE=1 SV=1 457 682 1.0E-14
sp|Q9UXF6|RFCL_SULSO Replication factor C large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcL PE=1 SV=1 459 679 2.0E-14
sp|A3DNV8|RFCL_STAMF Replication factor C large subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcL PE=3 SV=1 459 677 9.0E-14
sp|P0C1D3|CTF18_EMENI Chromosome transmission fidelity protein 18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ctf18 PE=3 SV=1 426 668 1.0E-13
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcL PE=1 SV=1 457 682 2.0E-13
sp|Q8BIW9|CTF18_MOUSE Chromosome transmission fidelity protein 18 homolog OS=Mus musculus GN=Chtf18 PE=1 SV=2 504 747 3.0E-13
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcL PE=3 SV=1 459 681 5.0E-12
sp|Q8SQM0|RFC4_ENCCU Replication factor C subunit 4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RFC4 PE=1 SV=1 455 679 6.0E-12
sp|B3E8F8|DNLJ_GEOLS DNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=ligA PE=3 SV=1 315 396 9.0E-12
sp|B9LHI6|DNLJ_CHLSY DNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=ligA PE=3 SV=1 297 387 1.0E-11
sp|A9WCA1|DNLJ_CHLAA DNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ligA PE=3 SV=1 297 387 1.0E-11
sp|A1K713|DNLJ_AZOSB DNA ligase OS=Azoarcus sp. (strain BH72) GN=ligA PE=3 SV=1 317 387 1.0E-11
sp|A5V1U3|DNLJ_ROSS1 DNA ligase OS=Roseiflexus sp. (strain RS-1) GN=ligA PE=3 SV=1 313 400 3.0E-11
sp|A7NHP6|DNLJ_ROSCS DNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=ligA PE=3 SV=1 313 387 4.0E-11
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcL PE=1 SV=3 457 682 4.0E-11
sp|Q5UQK9|RFCL_MIMIV Putative replication factor C large subunit OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R411 PE=3 SV=1 459 840 4.0E-11
sp|B9MIW4|DNLJ_ACIET DNA ligase OS=Acidovorax ebreus (strain TPSY) GN=ligA PE=3 SV=1 317 397 4.0E-11
sp|A1W7N4|DNLJ_ACISJ DNA ligase OS=Acidovorax sp. (strain JS42) GN=ligA PE=3 SV=1 317 396 9.0E-11
sp|Q1H1G6|DNLJ_METFK DNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ligA PE=3 SV=1 315 387 1.0E-10
sp|Q8XZJ7|DNLJ_RALSO DNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=ligA PE=3 SV=1 305 391 1.0E-10
sp|Q5NYU3|DNLJ_AROAE DNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=ligA PE=3 SV=1 317 389 2.0E-10
sp|A5GPI9|DNLJ_SYNPW DNA ligase OS=Synechococcus sp. (strain WH7803) GN=ligA PE=3 SV=1 315 389 2.0E-10
sp|A1WY80|DNLJ_HALHL DNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ligA PE=3 SV=1 306 387 3.0E-10
sp|Q112N5|DNLJ_TRIEI DNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=ligA PE=3 SV=1 304 385 3.0E-10
sp|A5N2X7|DNLJ_CLOK5 DNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=ligA PE=3 SV=1 315 388 3.0E-10
sp|B9DWM9|DNLJ_CLOK1 DNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=ligA PE=3 SV=1 315 388 3.0E-10
sp|Q3MGE7|DNLJ_ANAVT DNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ligA PE=3 SV=1 315 387 4.0E-10
sp|Q5N2P4|DNLJ_SYNP6 DNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ligA PE=3 SV=1 315 387 5.0E-10
sp|Q31RL0|DNLJ_SYNE7 DNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=ligA PE=3 SV=1 315 387 5.0E-10
sp|B8GAC1|DNLJ_CHLAD DNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ligA PE=3 SV=1 297 387 7.0E-10
sp|B0C308|DNLJ_ACAM1 DNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=ligA PE=3 SV=1 266 388 9.0E-10
sp|A9BZW4|DNLJ_DELAS DNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ligA PE=3 SV=1 315 387 9.0E-10
sp|Q604U8|DNLJ_METCA DNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ligA PE=3 SV=1 315 389 1.0E-09
sp|O66880|DNLJ_AQUAE DNA ligase OS=Aquifex aeolicus (strain VF5) GN=ligA PE=3 SV=1 313 388 1.0E-09
sp|B7K0A2|DNLJ_CYAP8 DNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=ligA PE=3 SV=1 315 387 1.0E-09
sp|Q47FA0|DNLJ_DECAR DNA ligase OS=Dechloromonas aromatica (strain RCB) GN=ligA PE=3 SV=1 308 389 2.0E-09
sp|Q21WC8|DNLJ_RHOFT DNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ligA PE=3 SV=1 315 387 2.0E-09
sp|A9BDC5|DNLJ_PROM4 DNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=ligA PE=3 SV=1 315 389 2.0E-09
sp|Q6L0P4|RFCL_PICTO Replication factor C large subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rfcL PE=3 SV=1 459 677 2.0E-09
sp|C1F7S7|DNLJ_ACIC5 DNA ligase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ligA PE=3 SV=1 315 387 2.0E-09
sp|A6SZQ8|DNLJ_JANMA DNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=ligA PE=3 SV=1 317 387 2.0E-09
sp|A1WRA7|DNLJ_VEREI DNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=ligA PE=3 SV=1 308 387 2.0E-09
sp|A4G4R4|DNLJ_HERAR DNA ligase OS=Herminiimonas arsenicoxydans GN=ligA PE=3 SV=1 315 387 2.0E-09
sp|B2J3P0|DNLJ_NOSP7 DNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ligA PE=3 SV=1 317 387 2.0E-09
sp|Q3AUH7|DNLJ_SYNS9 DNA ligase OS=Synechococcus sp. (strain CC9902) GN=ligA PE=3 SV=1 312 391 2.0E-09
sp|B2UB00|DNLJ_RALPJ DNA ligase OS=Ralstonia pickettii (strain 12J) GN=ligA PE=3 SV=1 314 389 2.0E-09
sp|A6WZR6|DNLJ_OCHA4 DNA ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ligA PE=3 SV=1 317 387 2.0E-09
sp|C1D4R5|DNLJ_LARHH DNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=ligA PE=3 SV=1 317 380 3.0E-09
sp|A8IGY0|DNLJ_AZOC5 DNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ligA PE=3 SV=1 317 387 3.0E-09
sp|Q8YW98|DNLJ_NOSS1 DNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ligA PE=3 SV=1 315 387 3.0E-09
sp|B3PGQ8|DNLJ_CELJU DNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=ligA PE=3 SV=1 286 389 3.0E-09
sp|Q1IHJ4|DNLJ_KORVE DNA ligase OS=Koribacter versatilis (strain Ellin345) GN=ligA PE=3 SV=1 315 389 3.0E-09
sp|Q54MH9|RFC1_DICDI Probable replication factor C subunit 1 OS=Dictyostelium discoideum GN=rfc1 PE=3 SV=1 308 389 4.0E-09
sp|B2KE31|DNLJ_ELUMP DNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=ligA PE=3 SV=1 315 388 4.0E-09
sp|B0JTW2|DNLJ_MICAN DNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=ligA PE=3 SV=1 315 388 4.0E-09
sp|B1Y6D4|DNLJ_LEPCP DNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ligA PE=3 SV=1 315 387 5.0E-09
sp|Q7NR81|DNLJ_CHRVO DNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ligA PE=3 SV=1 317 387 5.0E-09
sp|Q64TM7|DNLJ_BACFR DNA ligase OS=Bacteroides fragilis (strain YCH46) GN=ligA PE=3 SV=1 310 387 5.0E-09
sp|Q5LCI0|DNLJ_BACFN DNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ligA PE=3 SV=1 310 387 5.0E-09
sp|B1XTU0|DNLJ_POLNS DNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ligA PE=3 SV=1 317 388 5.0E-09
sp|Q5QUK1|DNLJ_IDILO DNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ligA PE=3 SV=1 308 387 6.0E-09
sp|A4SYV5|DNLJ_POLSQ DNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ligA PE=3 SV=1 315 388 6.0E-09
sp|Q01NV7|DNLJ_SOLUE DNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=ligA PE=3 SV=1 315 388 7.0E-09
sp|Q5F9Z9|DNLJ_NEIG1 DNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ligA PE=3 SV=1 309 387 7.0E-09
sp|B7K8U0|DNLJ_CYAP7 DNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=ligA PE=3 SV=1 285 387 8.0E-09
sp|Q12AD4|DNLJ_POLSJ DNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ligA PE=3 SV=1 315 387 8.0E-09
sp|Q2KUU5|DNLJ_BORA1 DNA ligase OS=Bordetella avium (strain 197N) GN=ligA PE=3 SV=1 299 387 9.0E-09
sp|B2JID1|DNLJ_BURP8 DNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ligA PE=3 SV=1 308 387 9.0E-09
sp|B4RJQ9|DNLJ_NEIG2 DNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ligA PE=3 SV=1 309 387 1.0E-08
sp|Q7XRX1|RFC4_ORYSJ Replication factor C subunit 4 OS=Oryza sativa subsp. japonica GN=RFC4 PE=2 SV=2 459 677 1.0E-08
sp|A1KSS7|DNLJ_NEIMF DNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ligA PE=3 SV=1 309 387 1.0E-08
sp|Q9K0E3|DNLJ_NEIMB DNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ligA PE=3 SV=1 309 387 1.0E-08
sp|A9M2U7|DNLJ_NEIM0 DNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ligA PE=3 SV=1 309 387 1.0E-08
sp|Q641W4|RFC2_RAT Replication factor C subunit 2 OS=Rattus norvegicus GN=Rfc2 PE=2 SV=1 447 677 1.0E-08
sp|A5GWQ3|DNLJ_SYNR3 DNA ligase OS=Synechococcus sp. (strain RCC307) GN=ligA PE=3 SV=1 315 387 1.0E-08
sp|Q2SD47|DNLJ_HAHCH DNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=ligA PE=3 SV=1 315 395 1.0E-08
sp|Q0AHH6|DNLJ_NITEC DNA ligase OS=Nitrosomonas eutropha (strain C91) GN=ligA PE=3 SV=2 317 390 1.0E-08
sp|Q46IA9|DNLJ_PROMT DNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=ligA PE=3 SV=1 317 383 1.0E-08
sp|A1IQR7|DNLJ_NEIMA DNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ligA PE=3 SV=1 309 387 1.0E-08
sp|A2C5E6|DNLJ_PROM1 DNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=ligA PE=3 SV=1 317 383 1.0E-08
sp|Q82TW6|DNLJ_NITEU DNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ligA PE=3 SV=1 317 388 2.0E-08
sp|A1S5R7|DNLJ_SHEAM DNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ligA PE=3 SV=1 308 387 2.0E-08
sp|O94449|RFC4_SCHPO Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc4 PE=1 SV=1 459 677 2.0E-08
sp|A2SGT2|DNLJ_METPP DNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=ligA PE=3 SV=1 310 387 2.0E-08
sp|Q05B83|RFC2_BOVIN Replication factor C subunit 2 OS=Bos taurus GN=RFC2 PE=2 SV=1 421 677 2.0E-08
sp|P40339|RFC4_YEAST Replication factor C subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC4 PE=1 SV=1 459 677 2.0E-08
sp|Q0I6C8|DNLJ_SYNS3 DNA ligase OS=Synechococcus sp. (strain CC9311) GN=ligA PE=3 SV=1 315 388 2.0E-08
sp|A9AXP4|DNLJ_HERA2 DNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=ligA PE=3 SV=1 305 387 2.0E-08
sp|C1D1Y6|DNLJ1_DEIDV DNA ligase 1 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=ligA1 PE=3 SV=1 297 387 2.0E-08
sp|Q9CAM7|RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana GN=RFC2 PE=1 SV=1 459 677 3.0E-08
sp|Q180F3|DNLJ_PEPD6 DNA ligase OS=Peptoclostridium difficile (strain 630) GN=ligA PE=3 SV=2 296 388 3.0E-08
sp|B1M575|DNLJ_METRJ DNA ligase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ligA PE=3 SV=1 298 387 3.0E-08
sp|Q0AAV2|DNLJ_ALKEH DNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ligA PE=3 SV=1 303 389 3.0E-08
sp|A9H0L6|DNLJ_GLUDA DNA ligase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=ligA PE=3 SV=1 296 386 3.0E-08
sp|A9II69|DNLJ_BORPD DNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ligA PE=3 SV=1 299 387 3.0E-08
sp|Q9ZFY8|DNLJ_THESK DNA ligase OS=Thermus sp. (strain AK16D) GN=ligA PE=3 SV=1 309 387 3.0E-08
sp|A7IG64|DNLJ_XANP2 DNA ligase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ligA PE=3 SV=1 317 387 3.0E-08
sp|A4JF81|DNLJ_BURVG DNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ligA PE=3 SV=1 308 387 3.0E-08
sp|A6LA55|DNLJ_PARD8 DNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ligA PE=3 SV=1 315 387 3.0E-08
sp|B1YSH2|DNLJ_BURA4 DNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=ligA PE=3 SV=1 308 387 5.0E-08
sp|A8FL10|DNLJ_CAMJ8 DNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ligA PE=3 SV=1 315 389 5.0E-08
sp|B1WZL6|DNLJ_CYAA5 DNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=ligA PE=3 SV=1 317 387 5.0E-08
sp|Q7VRX7|DNLJ_BORPE DNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ligA PE=3 SV=1 299 387 5.0E-08
sp|Q4QY64|ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus GN=Atad5 PE=1 SV=1 440 553 5.0E-08
sp|Q0BE10|DNLJ_BURCM DNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ligA PE=3 SV=1 308 387 5.0E-08
sp|Q96QE3|ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens GN=ATAD5 PE=1 SV=4 425 553 6.0E-08
sp|Q7WCJ7|DNLJ_BORBR DNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ligA PE=3 SV=1 299 387 6.0E-08
sp|B1VG01|DNLJ_CORU7 DNA ligase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=ligA PE=3 SV=1 313 394 6.0E-08
sp|A6L5G8|DNLJ_BACV8 DNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=ligA PE=3 SV=1 313 387 6.0E-08
sp|Q7W0T4|DNLJ_BORPA DNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ligA PE=3 SV=1 299 387 6.0E-08
sp|B5Y6V5|DNLJ_COPPD DNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=ligA PE=3 SV=1 309 389 6.0E-08
sp|B6IRF1|DNLJ_RHOCS DNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=ligA PE=3 SV=1 308 387 6.0E-08
sp|A9AIK9|DNLJ_BURM1 DNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ligA PE=3 SV=1 308 387 6.0E-08
sp|A5VRG5|DNLJ_BRUO2 DNA ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|P38629|RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC3 PE=1 SV=1 507 683 7.0E-08
sp|Q89FV8|DNLJ_BRADU DNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|P72588|DNLJ_SYNY3 DNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ligA PE=3 SV=1 315 387 7.0E-08
sp|Q8FZQ3|DNLJ_BRUSU DNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|B0CHK8|DNLJ_BRUSI DNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|A9M679|DNLJ_BRUC2 DNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|Q57C89|DNLJ_BRUAB DNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|Q2YLZ6|DNLJ_BRUA2 DNA ligase OS=Brucella abortus (strain 2308) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|B2S6P4|DNLJ_BRUA1 DNA ligase OS=Brucella abortus (strain S19) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|C0RE59|DNLJ_BRUMB DNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|A3DE88|DNLJ_CLOTH DNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|Q8YI56|DNLJ_BRUME DNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ligA PE=3 SV=1 317 387 7.0E-08
sp|P49422|DNLJ_THESC DNA ligase OS=Thermus scotoductus GN=ligA PE=1 SV=1 312 387 7.0E-08
sp|C0Z4D6|DNLJ_BREBN DNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ligA PE=3 SV=1 278 387 8.0E-08
sp|Q3IKB8|DNLJ_PSEHT DNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ligA PE=3 SV=1 308 389 8.0E-08
sp|O28219|RFCS_ARCFU Replication factor C small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcS PE=1 SV=1 454 682 8.0E-08
sp|Q5YRS7|DNLJ2_NOCFA DNA ligase 2 OS=Nocardia farcinica (strain IFM 10152) GN=ligA2 PE=3 SV=1 286 392 8.0E-08
sp|Q8A9C1|DNLJ_BACTN DNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=ligA PE=3 SV=1 297 387 8.0E-08
sp|Q9YBS7|RFCS_AERPE Replication factor C small subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcS PE=3 SV=3 454 682 9.0E-08
sp|Q9WUK4|RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus GN=Rfc2 PE=1 SV=1 459 677 9.0E-08
sp|C0QSF6|DNLJ_PERMH DNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ligA PE=3 SV=1 309 388 9.0E-08
sp|Q9CKA9|DNLJ_PASMU DNA ligase OS=Pasteurella multocida (strain Pm70) GN=ligA PE=3 SV=1 319 384 9.0E-08
sp|B8HFJ3|DNLJ1_ARTCA DNA ligase 1 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ligA1 PE=3 SV=1 314 413 1.0E-07
sp|Q0RDH8|DNLJ_FRAAA DNA ligase OS=Frankia alni (strain ACN14a) GN=ligA PE=3 SV=1 278 406 1.0E-07
sp|Q39F38|DNLJ_BURL3 DNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ligA PE=3 SV=1 308 387 1.0E-07
sp|Q8NR20|DNLJ_CORGL DNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ligA PE=3 SV=1 284 387 1.0E-07
sp|A1VN98|DNLJ_POLNA DNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ligA PE=3 SV=1 315 387 1.0E-07
sp|A1TR21|DNLJ_ACIAC DNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=ligA PE=3 SV=1 301 388 1.0E-07
sp|Q1D0P7|DNLJ_MYXXD DNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=ligA PE=3 SV=1 315 388 1.0E-07
sp|B1JUF5|DNLJ_BURCC DNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=ligA PE=3 SV=1 308 387 1.0E-07
sp|B4ECN6|DNLJ_BURCJ DNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ligA PE=3 SV=1 308 387 1.0E-07
sp|A0K8E8|DNLJ_BURCH DNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=ligA PE=3 SV=1 308 387 1.0E-07
sp|Q1BHI7|DNLJ_BURCA DNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=ligA PE=3 SV=2 308 387 1.0E-07
sp|Q8DKK2|DNLJ_THEEB DNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=ligA PE=3 SV=1 312 388 1.0E-07
sp|Q0PAT1|DNLJ_CAMJE DNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ligA PE=3 SV=1 315 389 1.0E-07
sp|Q5HVI4|DNLJ_CAMJR DNA ligase OS=Campylobacter jejuni (strain RM1221) GN=ligA PE=3 SV=1 315 389 1.0E-07
sp|A4QDK5|DNLJ_CORGB DNA ligase OS=Corynebacterium glutamicum (strain R) GN=ligA PE=3 SV=1 284 387 1.0E-07
sp|B2T5K0|DNLJ_BURPP DNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ligA PE=3 SV=1 308 387 1.0E-07
sp|B4U8X0|DNLJ_HYDS0 DNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ligA PE=3 SV=1 306 387 1.0E-07
sp|Q13XB0|DNLJ_BURXL DNA ligase OS=Burkholderia xenovorans (strain LB400) GN=ligA PE=3 SV=1 308 387 1.0E-07
sp|B8JD56|DNLJ_ANAD2 DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ligA PE=3 SV=1 317 389 2.0E-07
sp|A1R4P6|DNLJ_ARTAT DNA ligase OS=Arthrobacter aurescens (strain TC1) GN=ligA PE=3 SV=1 314 396 2.0E-07
sp|B9DRS2|DNLJ_STRU0 DNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=ligA PE=3 SV=1 315 386 2.0E-07
sp|B7GFV1|DNLJ_ANOFW DNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=ligA PE=3 SV=1 317 380 2.0E-07
sp|A1V575|DNLJ_BURMS DNA ligase OS=Burkholderia mallei (strain SAVP1) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|Q62JB9|DNLJ_BURMA DNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|A2SB66|DNLJ_BURM9 DNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|A3MKU9|DNLJ_BURM7 DNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|A1TZT9|DNLJ_MARHV DNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ligA PE=3 SV=1 303 389 2.0E-07
sp|A3NAV3|DNLJ_BURP6 DNA ligase OS=Burkholderia pseudomallei (strain 668) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|A3NWN7|DNLJ_BURP0 DNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|Q3JR23|DNLJ_BURP1 DNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|Q2N9V6|DNLJ_ERYLH DNA ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=ligA PE=3 SV=1 315 387 2.0E-07
sp|Q6FZ81|DNLJ_BARQU DNA ligase OS=Bartonella quintana (strain Toulouse) GN=ligA PE=3 SV=1 315 387 2.0E-07
sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3 421 677 2.0E-07
sp|B5EIJ0|DNLJ_GEOBB DNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ligA PE=3 SV=1 317 388 2.0E-07
sp|Q63T07|DNLJ_BURPS DNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|Q11GT5|DNLJ_CHESB DNA ligase OS=Chelativorans sp. (strain BNC1) GN=ligA PE=3 SV=1 317 387 2.0E-07
sp|Q7VMX7|DNLJ_HAEDU DNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ligA PE=3 SV=1 319 390 2.0E-07
sp|Q2SX03|DNLJ_BURTA DNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ligA PE=3 SV=1 308 387 2.0E-07
sp|Q8KF74|DNLJ_CHLTE DNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=ligA PE=3 SV=1 296 381 2.0E-07
sp|Q07PR9|DNLJ_RHOP5 DNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=ligA PE=3 SV=2 312 388 2.0E-07
sp|Q1J0I6|DNLJ_DEIGD DNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=ligA PE=3 SV=1 313 387 2.0E-07
sp|Q9FXM3|RFC2_ORYSJ Replication factor C subunit 2 OS=Oryza sativa subsp. japonica GN=RFC2 PE=2 SV=1 507 682 2.0E-07
sp|B4UDH6|DNLJ_ANASK DNA ligase OS=Anaeromyxobacter sp. (strain K) GN=ligA PE=3 SV=1 317 389 2.0E-07
sp|B0K3S1|DNLJ_THEPX DNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=ligA PE=3 SV=1 317 388 2.0E-07
sp|A7H3U4|DNLJ_CAMJD DNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=ligA PE=3 SV=1 315 389 2.0E-07
sp|Q1LNG5|DNLJ_CUPMC DNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ligA PE=3 SV=1 297 392 3.0E-07
sp|C1DN27|DNLJ_AZOVD DNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ligA PE=3 SV=1 309 390 3.0E-07
sp|A9A0L9|DNLJ_DESOH DNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=ligA PE=3 SV=1 310 387 3.0E-07
sp|A4YZJ3|DNLJ_BRASO DNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=ligA PE=3 SV=1 319 387 3.0E-07
sp|Q4JAB0|RFCS_SULAC Replication factor C small subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcS PE=3 SV=1 455 682 3.0E-07
sp|A5EPJ2|DNLJ_BRASB DNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ligA PE=3 SV=1 319 387 3.0E-07
sp|Q72JN8|DNLJ_THET2 DNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ligA PE=3 SV=1 313 387 3.0E-07
sp|P26996|DNLJ_THET8 DNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ligA PE=1 SV=1 313 387 3.0E-07
sp|C0M6L2|DNLJ_STRE4 DNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=ligA PE=3 SV=1 311 386 3.0E-07
sp|Q71YR0|DNLJ_LISMF DNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ligA PE=3 SV=1 311 395 4.0E-07
sp|B4U2C7|DNLJ_STREM DNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=ligA PE=3 SV=1 315 386 4.0E-07
sp|B1ZWH2|DNLJ1_OPITP DNA ligase 1 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ligA1 PE=3 SV=1 315 387 4.0E-07
sp|Q2INT9|DNLJ_ANADE DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ligA PE=3 SV=1 317 389 4.0E-07
sp|A0LZ23|DNLJ_GRAFK DNA ligase OS=Gramella forsetii (strain KT0803) GN=ligA PE=3 SV=1 298 387 4.0E-07
sp|P49421|DNLJ_RHOMR DNA ligase OS=Rhodothermus marinus GN=ligA PE=1 SV=1 307 387 4.0E-07
sp|Q8Y6D0|DNLJ_LISMO DNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ligA PE=3 SV=1 311 395 4.0E-07
sp|C1KW57|DNLJ_LISMC DNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ligA PE=3 SV=1 311 395 4.0E-07
sp|P34429|RFC5_CAEEL Probable replication factor C subunit 5 OS=Caenorhabditis elegans GN=F44B9.8 PE=3 SV=3 507 692 4.0E-07
sp|Q92AQ0|DNLJ_LISIN DNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ligA PE=3 SV=1 311 395 4.0E-07
sp|Q21JI8|DNLJ_SACD2 DNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ligA PE=3 SV=1 315 389 4.0E-07
sp|B8DFG5|DNLJ_LISMH DNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ligA PE=3 SV=1 311 395 5.0E-07
sp|Q133Y4|DNLJ_RHOPS DNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=ligA PE=3 SV=1 311 387 5.0E-07
sp|A0AJL1|DNLJ_LISW6 DNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ligA PE=3 SV=1 311 395 5.0E-07
sp|O87703|DNLJ_GEOSE DNA ligase OS=Geobacillus stearothermophilus GN=ligA PE=1 SV=1 292 389 5.0E-07
sp|B8ETN6|DNLJ_METSB DNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ligA PE=3 SV=1 300 387 5.0E-07
sp|B8HV17|DNLJ_CYAP4 DNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ligA PE=3 SV=1 315 375 5.0E-07
sp|B0BQN6|DNLJ_ACTPJ DNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ligA PE=3 SV=1 315 386 6.0E-07
sp|Q3AGK2|DNLJ_SYNSC DNA ligase OS=Synechococcus sp. (strain CC9605) GN=ligA PE=3 SV=1 314 388 6.0E-07
sp|Q9RSQ5|DNLJ_DEIRA DNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ligA PE=3 SV=1 308 387 6.0E-07
sp|Q2GDR2|DNLJ_NEOSM DNA ligase OS=Neorickettsia sennetsu (strain Miyayama) GN=ligA PE=3 SV=1 315 386 6.0E-07
sp|Q5L3B9|DNLJ_GEOKA DNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=ligA PE=3 SV=1 292 389 6.0E-07
sp|Q5M382|DNLJ_STRT2 DNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ligA PE=3 SV=1 314 386 6.0E-07
sp|Q5LYL9|DNLJ_STRT1 DNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ligA PE=3 SV=1 314 386 6.0E-07
sp|Q03JF6|DNLJ_STRTD DNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ligA PE=3 SV=2 314 386 6.0E-07
sp|A9IW95|DNLJ_BART1 DNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ligA PE=3 SV=1 301 388 6.0E-07
sp|Q8PVY4|RFCS_METMA Replication factor C small subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcS PE=3 SV=1 454 682 7.0E-07
sp|B2RKL2|DNLJ_PORG3 DNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ligA PE=3 SV=1 315 387 7.0E-07
sp|Q92NM8|DNLJ_RHIME DNA ligase OS=Rhizobium meliloti (strain 1021) GN=ligA PE=3 SV=1 303 387 7.0E-07
sp|P43813|DNLJ_HAEIN DNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ligA PE=1 SV=2 303 380 8.0E-07
sp|B9MK54|DNLJ_CALBD DNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ligA PE=3 SV=1 313 390 8.0E-07
sp|A5UIM6|DNLJ_HAEIG DNA ligase OS=Haemophilus influenzae (strain PittGG) GN=ligA PE=3 SV=1 303 380 8.0E-07
sp|Q1RK40|DNLJ_RICBR DNA ligase OS=Rickettsia bellii (strain RML369-C) GN=ligA PE=3 SV=1 311 390 8.0E-07
sp|A8GXT8|DNLJ_RICB8 DNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=ligA PE=3 SV=1 311 390 8.0E-07
sp|A2RFD0|DNLJ_STRPG DNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ligA PE=3 SV=1 315 390 8.0E-07
sp|Q1JHP3|DNLJ_STRPD DNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ligA PE=3 SV=1 315 390 8.0E-07
sp|Q8P1L1|DNLJ_STRP8 DNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ligA PE=3 SV=1 315 390 8.0E-07
sp|Q8TSX5|RFCS_METAC Replication factor C small subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcS PE=3 SV=1 449 687 8.0E-07
sp|Q4QLJ0|DNLJ_HAEI8 DNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=ligA PE=3 SV=2 303 380 8.0E-07
sp|Q87RJ4|DNLJ_VIBPA DNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ligA PE=3 SV=1 301 387 8.0E-07
sp|A5UD04|DNLJ_HAEIE DNA ligase OS=Haemophilus influenzae (strain PittEE) GN=ligA PE=3 SV=1 303 380 8.0E-07
sp|C3L496|DNLJ_AMOA5 DNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=ligA PE=3 SV=1 315 387 8.0E-07
sp|Q6N423|DNLJ_RHOPA DNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ligA PE=3 SV=2 317 387 8.0E-07
sp|A0JUH2|DNLJ_ARTS2 DNA ligase OS=Arthrobacter sp. (strain FB24) GN=ligA PE=3 SV=1 314 391 9.0E-07
sp|B0KBN6|DNLJ_THEP3 DNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ligA PE=3 SV=1 317 388 9.0E-07
sp|Q6G2R5|DNLJ_BARHE DNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ligA PE=3 SV=1 315 387 9.0E-07
sp|B3QFL8|DNLJ_RHOPT DNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ligA PE=3 SV=1 317 387 1.0E-06
sp|Q080K9|DNLJ_SHEFN DNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=ligA PE=3 SV=1 315 387 1.0E-06
sp|A8L538|DNLJ_FRASN DNA ligase OS=Frankia sp. (strain EAN1pec) GN=ligA PE=3 SV=1 315 388 1.0E-06
sp|B3R2C2|DNLJ_CUPTR DNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ligA PE=3 SV=1 315 383 1.0E-06
sp|Q8E5W1|DNLJ_STRA3 DNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ligA PE=3 SV=1 315 386 1.0E-06
sp|Q47SC6|DNLJ_THEFY DNA ligase OS=Thermobifida fusca (strain YX) GN=ligA PE=3 SV=1 285 414 1.0E-06
sp|B3QSH0|DNLJ_CHLT3 DNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=ligA PE=3 SV=1 317 380 1.0E-06
sp|Q5UQ47|RFCS1_MIMIV Putative replication factor C small subunit R395 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R395 PE=3 SV=1 507 752 1.0E-06
sp|Q3K1K8|DNLJ_STRA1 DNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ligA PE=3 SV=1 315 386 1.0E-06
sp|Q8E084|DNLJ_STRA5 DNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ligA PE=3 SV=1 315 386 1.0E-06
sp|A4J703|DNLJ_DESRM DNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=ligA PE=3 SV=1 297 389 1.0E-06
sp|B9J1L6|DNLJ_BACCQ DNA ligase OS=Bacillus cereus (strain Q1) GN=ligA PE=3 SV=2 294 380 1.0E-06
sp|B7HSW5|DNLJ_BACC7 DNA ligase OS=Bacillus cereus (strain AH187) GN=ligA PE=3 SV=1 294 380 1.0E-06
sp|C1A6H2|DNLJ_GEMAT DNA ligase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=ligA PE=3 SV=1 314 385 1.0E-06
sp|Q0KA11|DNLJ_CUPNH DNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ligA PE=3 SV=1 315 383 1.0E-06
sp|A3DNV9|RFCS_STAMF Replication factor C small subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcS PE=3 SV=1 451 682 1.0E-06
sp|Q73EM3|DNLJ_BACC1 DNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ligA PE=3 SV=1 294 380 1.0E-06
sp|Q3ITK1|DNLJ_NATPD DNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ligA PE=3 SV=1 313 387 1.0E-06
sp|A1VYU6|DNLJ_CAMJJ DNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ligA PE=3 SV=1 315 389 1.0E-06
sp|A5EVZ5|DNLJ_DICNV DNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=ligA PE=3 SV=1 315 383 1.0E-06
sp|B1HTW6|DNLJ_LYSSC DNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=ligA PE=3 SV=1 317 385 1.0E-06
sp|Q2RGY0|DNLJ_MOOTA DNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=ligA PE=3 SV=1 315 389 1.0E-06
sp|Q3A2F5|DNLJ_PELCD DNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ligA PE=3 SV=1 315 390 1.0E-06
sp|A9CIB3|DNLJ_AGRFC DNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ligA PE=3 SV=1 299 387 1.0E-06
sp|A3N1V2|DNLJ_ACTP2 DNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ligA PE=3 SV=1 315 386 1.0E-06
sp|B2GL64|DNLJ_KOCRD DNA ligase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ligA PE=3 SV=1 287 394 1.0E-06
sp|Q7MV47|DNLJ_PORGI DNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ligA PE=3 SV=1 315 387 1.0E-06
sp|Q9I3I4|DNLJ_PSEAE DNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ligA PE=3 SV=1 315 387 1.0E-06
sp|Q02K12|DNLJ_PSEAB DNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ligA PE=3 SV=1 315 387 1.0E-06
sp|B7UVJ3|DNLJ_PSEA8 DNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=ligA PE=3 SV=1 315 387 1.0E-06
sp|Q9A0J5|DNLJ_STRP1 DNA ligase OS=Streptococcus pyogenes serotype M1 GN=ligA PE=3 SV=1 315 383 1.0E-06
sp|B5XKP3|DNLJ_STRPZ DNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=ligA PE=3 SV=1 315 383 1.0E-06
sp|Q48UE1|DNLJ_STRPM DNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ligA PE=3 SV=1 315 383 1.0E-06
sp|Q1J7G9|DNLJ_STRPF DNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ligA PE=3 SV=1 315 383 1.0E-06
sp|A6V7X3|DNLJ_PSEA7 DNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=ligA PE=3 SV=1 315 387 1.0E-06
sp|Q5XCY8|DNLJ_STRP6 DNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ligA PE=3 SV=1 315 383 2.0E-06
sp|A7I8Y0|RFCS_METB6 Replication factor C small subunit OS=Methanoregula boonei (strain 6A8) GN=rfcS PE=3 SV=1 459 684 2.0E-06
sp|A5CZ68|DNLJ_PELTS DNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=ligA PE=3 SV=1 315 386 2.0E-06
sp|Q470D2|DNLJ_CUPPJ DNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ligA PE=3 SV=1 315 392 2.0E-06
sp|Q1JMJ7|DNLJ_STRPC DNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ligA PE=3 SV=1 315 383 2.0E-06
sp|Q1JCM1|DNLJ_STRPB DNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ligA PE=3 SV=1 315 383 2.0E-06
sp|Q2YBB7|DNLJ_NITMU DNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ligA PE=3 SV=1 315 392 2.0E-06
sp|B3H275|DNLJ_ACTP7 DNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ligA PE=3 SV=1 315 386 2.0E-06
sp|P0DA73|DNLJ_STRPQ DNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ligA PE=3 SV=1 315 383 2.0E-06
sp|P0DA72|DNLJ_STRP3 DNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ligA PE=3 SV=1 315 383 2.0E-06
sp|Q1QNT2|DNLJ_NITHX DNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ligA PE=3 SV=1 312 387 2.0E-06
sp|B3QLI5|DNLJ_CHLP8 DNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ligA PE=3 SV=1 287 381 2.0E-06
sp|Q6M044|RFCS_METMP Replication factor C small subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcS PE=3 SV=1 507 682 2.0E-06
sp|Q6YZ54|RFC3_ORYSJ Replication factor C subunit 3 OS=Oryza sativa subsp. japonica GN=RFC3 PE=2 SV=1 507 684 2.0E-06
sp|Q93ZX1|RFC4_ARATH Replication factor C subunit 4 OS=Arabidopsis thaliana GN=RFC4 PE=2 SV=1 447 682 2.0E-06
sp|A6W7L4|DNLJ_KINRD DNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=ligA PE=3 SV=1 315 391 2.0E-06
sp|Q6A7A2|DNLJ_PROAC DNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=ligA PE=3 SV=1 284 391 2.0E-06
sp|A7HVV8|DNLJ_PARL1 DNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ligA PE=3 SV=1 315 386 2.0E-06
sp|A7MT54|DNLJ_VIBCB DNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ligA PE=3 SV=1 309 388 2.0E-06
sp|Q2IYJ4|DNLJ_RHOP2 DNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=ligA PE=3 SV=1 315 387 2.0E-06
sp|Q47YI0|DNLJ_COLP3 DNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ligA PE=3 SV=1 320 387 2.0E-06
sp|A6UB73|DNLJ_SINMW DNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=ligA PE=3 SV=1 303 387 2.0E-06
sp|A5VFJ8|DNLJ_SPHWW DNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=ligA PE=3 SV=1 317 387 2.0E-06
sp|B7IUW5|DNLJ_BACC2 DNA ligase OS=Bacillus cereus (strain G9842) GN=ligA PE=3 SV=1 294 380 2.0E-06
sp|B0USD9|DNLJ_HISS2 DNA ligase OS=Histophilus somni (strain 2336) GN=ligA PE=3 SV=1 304 387 2.0E-06
sp|Q7V3Z9|DNLJ_PROMM DNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=ligA PE=3 SV=1 315 387 2.0E-06
sp|Q8FPZ7|DNLJ_COREF DNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ligA PE=3 SV=1 244 387 3.0E-06
sp|A4VKN0|DNLJ_PSEU5 DNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=ligA PE=3 SV=2 315 390 3.0E-06
sp|A7H8A2|DNLJ_ANADF DNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ligA PE=3 SV=1 317 387 3.0E-06
sp|B8F314|DNLJ_HAEPS DNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ligA PE=3 SV=1 299 384 3.0E-06
sp|Q7U3P1|DNLJ_SYNPX DNA ligase OS=Synechococcus sp. (strain WH8102) GN=ligA PE=3 SV=1 315 387 3.0E-06
sp|Q9ZHI0|DNLJ_THEFI DNA ligase OS=Thermus filiformis GN=ligA PE=1 SV=2 313 389 3.0E-06
sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2 507 682 3.0E-06
sp|A4FZ74|RFCS_METM5 Replication factor C small subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcS PE=3 SV=1 507 682 3.0E-06
sp|Q2G7J5|DNLJ_NOVAD DNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ligA PE=3 SV=1 309 389 3.0E-06
sp|A6VJ61|RFCS_METM7 Replication factor C small subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcS PE=3 SV=1 507 682 3.0E-06
sp|A9A6K6|RFCS_METM6 Replication factor C small subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcS PE=3 SV=1 507 682 3.0E-06
sp|B1Z9P1|DNLJ_METPB DNA ligase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ligA PE=3 SV=1 317 387 3.0E-06
sp|Q3ATX4|DNLJ_CHLCH DNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=ligA PE=3 SV=1 317 387 3.0E-06
sp|Q2LTN8|DNLJ_SYNAS DNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=ligA PE=3 SV=1 315 390 3.0E-06
sp|Q9Z585|DNLJ1_STRCO DNA ligase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ligA1 PE=3 SV=1 286 391 3.0E-06
sp|A9VRG3|DNLJ_BACWK DNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ligA PE=3 SV=1 294 380 3.0E-06
sp|C1CVC7|DNLJ2_DEIDV DNA ligase 2 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=ligA2 PE=3 SV=1 315 389 3.0E-06
sp|Q8DPS9|DNLJ_STRR6 DNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ligA PE=3 SV=1 315 383 3.0E-06
sp|C1C7B1|DNLJ_STRP7 DNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=ligA PE=3 SV=1 315 383 3.0E-06
sp|Q04KH2|DNLJ_STRP2 DNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ligA PE=3 SV=1 315 383 3.0E-06
sp|Q3ZX08|DNLJ_DEHMC DNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=ligA PE=3 SV=1 317 389 3.0E-06
sp|B1IBQ3|DNLJ_STRPI DNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ligA PE=3 SV=1 315 383 3.0E-06
sp|Q0I2H6|DNLJ_HAES1 DNA ligase OS=Haemophilus somnus (strain 129Pt) GN=ligA PE=3 SV=1 305 387 3.0E-06
sp|C1CRL7|DNLJ_STRZT DNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ligA PE=3 SV=1 315 383 4.0E-06
sp|C1CKI0|DNLJ_STRZP DNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=ligA PE=1 SV=1 315 383 4.0E-06
sp|B5E4M9|DNLJ_STRP4 DNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ligA PE=3 SV=1 315 383 4.0E-06
sp|Q8RC42|DNLJ_CALS4 DNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ligA PE=3 SV=1 317 380 4.0E-06
sp|Q0S2J2|DNLJ_RHOJR DNA ligase OS=Rhodococcus jostii (strain RHA1) GN=ligA PE=3 SV=1 315 391 4.0E-06
sp|A4IJY6|DNLJ_GEOTN DNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ligA PE=3 SV=1 314 389 4.0E-06
sp|Q83DZ6|DNLJ_COXBU DNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ligA PE=3 SV=2 315 388 4.0E-06
sp|A9NC33|DNLJ_COXBR DNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ligA PE=3 SV=1 315 388 4.0E-06
sp|Q97QT2|DNLJ_STRPN DNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ligA PE=3 SV=1 315 383 4.0E-06
sp|B6J878|DNLJ_COXB1 DNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=ligA PE=3 SV=1 315 388 4.0E-06
sp|C1CEA4|DNLJ_STRZJ DNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=ligA PE=3 SV=1 315 383 4.0E-06
sp|B2IPZ1|DNLJ_STRPS DNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=ligA PE=3 SV=1 315 383 4.0E-06
sp|B8ZPV9|DNLJ_STRPJ DNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ligA PE=3 SV=1 315 383 4.0E-06
sp|Q5ZWX6|DNLJ_LEGPH DNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ligA PE=3 SV=2 311 381 4.0E-06
sp|Q81IP2|DNLJ_BACCR DNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|Q5WXV3|DNLJ_LEGPL DNA ligase OS=Legionella pneumophila (strain Lens) GN=ligA PE=3 SV=1 311 381 4.0E-06
sp|A4Y802|DNLJ_SHEPC DNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ligA PE=3 SV=1 308 387 4.0E-06
sp|Q46C63|RFCS_METBF Replication factor C small subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcS PE=3 SV=1 454 694 4.0E-06
sp|Q6HP94|DNLJ_BACHK DNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|C1EV74|DNLJ_BACC3 DNA ligase OS=Bacillus cereus (strain 03BB102) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|A0R906|DNLJ_BACAH DNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|A9KCS0|DNLJ_COXBN DNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ligA PE=3 SV=1 315 388 4.0E-06
sp|A1RII7|DNLJ_SHESW DNA ligase OS=Shewanella sp. (strain W3-18-1) GN=ligA PE=3 SV=1 308 387 4.0E-06
sp|B6J1C6|DNLJ_COXB2 DNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=ligA PE=3 SV=1 315 388 4.0E-06
sp|B7JM96|DNLJ_BACC0 DNA ligase OS=Bacillus cereus (strain AH820) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|Q63GS3|DNLJ_BACCZ DNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|A4FMS5|DNLJ_SACEN DNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ligA PE=3 SV=1 309 389 4.0E-06
sp|Q81ZG1|DNLJ_BACAN DNA ligase OS=Bacillus anthracis GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|C3L543|DNLJ_BACAC DNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|C3PBP1|DNLJ_BACAA DNA ligase OS=Bacillus anthracis (strain A0248) GN=ligA PE=3 SV=1 294 380 4.0E-06
sp|B7IDX6|DNLJ_THEAB DNA ligase OS=Thermosipho africanus (strain TCF52B) GN=ligA PE=3 SV=1 296 381 4.0E-06
sp|Q6MRL9|DNLJ_BDEBA DNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ligA PE=3 SV=1 311 378 4.0E-06
sp|Q99J62|RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus GN=Rfc4 PE=1 SV=1 507 682 5.0E-06
sp|B6JB45|DNLJ_OLICO DNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=ligA PE=3 SV=1 312 387 5.0E-06
sp|Q0HWD2|DNLJ_SHESR DNA ligase OS=Shewanella sp. (strain MR-7) GN=ligA PE=3 SV=2 308 387 5.0E-06
sp|A6LN55|DNLJ_THEM4 DNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=ligA PE=3 SV=1 313 387 5.0E-06
sp|Q0HK31|DNLJ_SHESM DNA ligase OS=Shewanella sp. (strain MR-4) GN=ligA PE=3 SV=2 308 387 5.0E-06
sp|A9VWA4|DNLJ_METEP DNA ligase OS=Methylobacterium extorquens (strain PA1) GN=ligA PE=3 SV=1 317 387 5.0E-06
sp|A0KVI4|DNLJ_SHESA DNA ligase OS=Shewanella sp. (strain ANA-3) GN=ligA PE=3 SV=2 308 387 5.0E-06
sp|Q8ED70|DNLJ_SHEON DNA ligase OS=Shewanella oneidensis (strain MR-1) GN=ligA PE=3 SV=1 308 387 5.0E-06
sp|B7KU78|DNLJ_METC4 DNA ligase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=ligA PE=3 SV=1 317 387 5.0E-06
sp|B6YRR9|DNLJ_AZOPC DNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=ligA PE=3 SV=1 315 387 5.0E-06
sp|Q0W037|RFCS_METAR Replication factor C small subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcS PE=3 SV=1 454 682 5.0E-06
sp|Q0VR01|DNLJ_ALCBS DNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ligA PE=3 SV=1 309 389 5.0E-06
sp|B7H4U8|DNLJ_BACC4 DNA ligase OS=Bacillus cereus (strain B4264) GN=ligA PE=3 SV=1 294 380 6.0E-06
sp|B8ICE5|DNLJ_METNO DNA ligase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ligA PE=3 SV=1 317 380 6.0E-06
sp|A5GA98|DNLJ_GEOUR DNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=ligA PE=3 SV=1 315 387 6.0E-06
sp|B2IGH4|DNLJ_BEII9 DNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ligA PE=3 SV=1 300 387 6.0E-06
sp|Q6NHQ4|DNLJ_CORDI DNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=ligA PE=3 SV=1 287 387 6.0E-06
sp|A2CDS6|DNLJ_PROM3 DNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=ligA PE=3 SV=1 315 369 6.0E-06
sp|Q1GVQ2|DNLJ_SPHAL DNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ligA PE=3 SV=1 317 380 6.0E-06
sp|B5ZWH9|DNLJ_RHILW DNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ligA PE=3 SV=1 303 387 6.0E-06
sp|A5IY71|DNLJ_MYCAP DNA ligase OS=Mycoplasma agalactiae (strain PG2) GN=ligA PE=3 SV=1 314 389 6.0E-06
sp|A1A200|DNLJ_BIFAA DNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=ligA PE=3 SV=1 287 387 6.0E-06
sp|A5IFV1|DNLJ_LEGPC DNA ligase OS=Legionella pneumophila (strain Corby) GN=ligA PE=3 SV=1 311 381 7.0E-06
sp|Q3Z8W1|DNLJ_DEHM1 DNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=ligA PE=3 SV=1 315 389 7.0E-06
sp|Q2J6U3|DNLJ_FRASC DNA ligase OS=Frankia sp. (strain CcI3) GN=ligA PE=3 SV=1 315 387 7.0E-06
sp|Q7V9J2|DNLJ_PROMA DNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ligA PE=3 SV=1 317 387 7.0E-06
sp|P53033|RFC2_CHICK Replication factor C subunit 2 OS=Gallus gallus GN=RFC2 PE=2 SV=1 440 677 7.0E-06
sp|A1RV38|RFCS2_PYRIL Replication factor C small subunit 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS2 PE=3 SV=1 459 692 7.0E-06
sp|A9NHW0|DNLJ_ACHLI DNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=ligA PE=3 SV=1 317 380 8.0E-06
sp|A4TMG4|DNLJ_YERPP DNA ligase OS=Yersinia pestis (strain Pestoides F) GN=ligA PE=3 SV=1 317 387 8.0E-06
sp|Q1CJV7|DNLJ_YERPN DNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ligA PE=3 SV=1 317 387 8.0E-06
sp|A9QZH0|DNLJ_YERPG DNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ligA PE=3 SV=1 317 387 8.0E-06
sp|Q7CJF3|DNLJ_YERPE DNA ligase OS=Yersinia pestis GN=ligA PE=3 SV=1 317 387 8.0E-06
sp|Q1C5X9|DNLJ_YERPA DNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ligA PE=3 SV=1 317 387 8.0E-06
sp|C0ZXK3|DNLJ_RHOE4 DNA ligase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ligA PE=3 SV=1 315 391 8.0E-06
sp|A8F2K5|DNLJ_RICM5 DNA ligase OS=Rickettsia massiliae (strain Mtu5) GN=ligA PE=3 SV=1 321 390 8.0E-06
sp|C1B1S4|DNLJ_RHOOB DNA ligase OS=Rhodococcus opacus (strain B4) GN=ligA PE=3 SV=1 315 391 8.0E-06
sp|Q0AMX9|DNLJ_MARMM DNA ligase OS=Maricaulis maris (strain MCS10) GN=ligA PE=3 SV=1 315 387 8.0E-06
sp|A8M5E3|DNLJ_SALAI DNA ligase OS=Salinispora arenicola (strain CNS-205) GN=ligA PE=3 SV=1 315 387 8.0E-06
sp|Q3JAI1|DNLJ_NITOC DNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ligA PE=3 SV=1 299 381 8.0E-06
sp|Q74ER9|DNLJ_GEOSL DNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ligA PE=3 SV=1 315 387 8.0E-06
sp|Q668M6|DNLJ_YERPS DNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ligA PE=3 SV=1 317 387 9.0E-06
sp|B2K917|DNLJ_YERPB DNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ligA PE=3 SV=1 317 387 9.0E-06
sp|B1JFZ0|DNLJ_YERPY DNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ligA PE=3 SV=1 317 387 9.0E-06
sp|A7FGC2|DNLJ_YERP3 DNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ligA PE=3 SV=1 317 387 9.0E-06
sp|Q54E21|RFC2_DICDI Probable replication factor C subunit 2 OS=Dictyostelium discoideum GN=rfc2 PE=3 SV=1 459 677 9.0E-06
sp|Q1ME47|DNLJ_RHIL3 DNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ligA PE=3 SV=1 303 387 9.0E-06
sp|A6H0N9|DNLJ_FLAPJ DNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=ligA PE=3 SV=1 315 380 1.0E-05
sp|B8DU32|DNLJ_BIFA0 DNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=ligA PE=3 SV=1 264 387 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATP hydrolysis activity Yes
GO:0005524 ATP binding Yes
GO:0003689 DNA clamp loader activity Yes
GO:0005663 DNA replication factor C complex Yes
GO:0006260 DNA replication Yes
GO:0006259 DNA metabolic process No
GO:0016787 hydrolase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140657 ATP-dependent activity No
GO:0032991 protein-containing complex No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032553 ribonucleotide binding No
GO:0140097 catalytic activity, acting on DNA No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003674 molecular_function No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016462 pyrophosphatase activity No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup858
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4352 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3270
Ophiocordyceps camponoti-floridani Ophcf2|06650
Ophiocordyceps camponoti-rufipedis Ophun1|5110
Ophiocordyceps kimflemingae Ophio5|5298
Ophiocordyceps subramaniannii Hirsu2|4782

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4352
MPDIRSFFSAKGSTASKPAPPKKEALSNSKRASRKVVQDSDDDEPAPEQTPAKAASKPAPKKKKSDLEPEGIPIS
AEDYFASTKDGKKRQTKSALPTETKPSPKSQPAVRSSPRKHKTTAKTSEPAPKSALSKKKTVSYEQHEGADDDAH
LSEAEQGGQDIYAADYQGAGKRMPDDYVDSASEEEIKPKTKRVSSRKSNTTSTGAAEEPKPARQTAAASKKKRKS
PTSDDSDAEELPRKKLTPAKPRAPRKKADEPEDESIQSILDSVATVRPPTPPPKDPAAKFDWRKAGASGGNAAVQ
PMQSADLPEGEEDCLMGLSFVFTGVLQTIGRDEAQALVKRYGGKVTGQPSTKTSFVVLGQDAGPSKLAKIHSHGI
KTIDENGLFDLIRKLPAYGGSGKGAQKAQEKKKTEEEKVKRQVAEMEAEDKANKAAEAKQARTAAASGSAAAPAR
TTAQLLTSKYAPTQMNHLCGNKAHIEKIQTWLRNWPKSKKYNFQRRGADGMGGERAIIISGPPGIGKTTAAHLAA
KLEGYDILESNASDTRSKKLVEAGVSDAMNNTSLRGFFSGDGKAVDATKKKLVLIMDEVDGMSAGDRGGVGALAK
FCRKTEVPLILICNERRLPKMKPFDHVAFDVRFNRPTTDQVRSRIMTICHREGLKLPPQVIDALIEGSNKDIRQI
INMIATAKLDQTSMNYDQGKAMTKAWEKHVILKPWDICQKILGGGLFAPASKATLNDKIELYFNDHEFSFLMIQE
NYLRTKPMLLSGKGYTKREERVKALELFDQAAESISDGDLVDRMIHGPQQHWSLMPTHAVFSTVRPASFVAGQLV
GSAFTSWLGNFSKTGKLGRYVREIHSHMRLKSSGDHNEVRQQYMPLLWDRLVHRLQVEGTEAVEHVIGLMDSYYL
TREDFDAIQELGVGPMAEENVRIETKTKASFTRQYNAMNHPVPFIKASNVLAPKAQAKEAPDLEEAIEEADDAAE
VVEAPEADDDELDLKKDKYIKVPKAKKASKKRQAPAAADDEDEKPKGRPRGKKAKK*
Coding >OphauG2|4352
ATGCCGGATATCAGATCCTTCTTCTCAGCCAAAGGCTCTACAGCCTCGAAACCGGCGCCTCCGAAAAAGGAGGCA
CTGTCCAATTCCAAAAGAGCGAGCCGAAAAGTTGTTCAGGACAGCGACGACGACGAGCCTGCCCCCGAGCAAACG
CCGGCAAAGGCAGCCTCGAAACCGGCCCCCAAGAAGAAAAAAAGCGATTTAGAGCCCGAAGGCATTCCAATATCC
GCTGAAGATTATTTTGCTTCGACTAAAGACGGCAAAAAGCGCCAAACAAAGTCGGCCCTGCCGACTGAGACCAAG
CCCTCACCTAAATCACAGCCTGCCGTACGGTCGAGCCCTCGCAAACATAAAACCACGGCCAAGACATCTGAACCA
GCTCCCAAAAGCGCTCTTTCTAAGAAAAAGACGGTTTCATATGAGCAGCATGAAGGCGCAGACGATGATGCTCAC
CTGTCGGAGGCAGAGCAAGGTGGACAGGACATATATGCGGCCGACTATCAAGGCGCAGGGAAGCGAATGCCCGAT
GATTATGTTGACAGCGCATCCGAGGAAGAGATCAAGCCCAAGACAAAACGTGTTTCCTCCCGAAAATCGAATACC
ACTTCAACAGGAGCCGCCGAAGAGCCTAAACCTGCCCGGCAGACTGCTGCTGCCTCAAAGAAGAAACGAAAATCG
CCGACATCAGATGACTCAGATGCCGAGGAATTGCCTCGAAAGAAGCTGACACCTGCCAAGCCACGAGCTCCTCGA
AAGAAGGCCGACGAGCCCGAAGACGAGAGTATTCAAAGCATACTAGACAGTGTTGCAACAGTTCGGCCGCCGACA
CCGCCACCCAAGGATCCAGCCGCCAAGTTTGACTGGAGAAAAGCTGGAGCAAGTGGAGGAAATGCCGCAGTCCAG
CCAATGCAATCTGCAGACCTGCCAGAAGGAGAAGAAGACTGCCTCATGGGGCTCTCGTTTGTCTTCACCGGCGTC
CTGCAAACGATTGGGCGCGACGAGGCACAGGCGCTGGTTAAGCGATACGGGGGCAAAGTAACAGGGCAGCCGAGC
ACCAAAACAAGCTTTGTCGTGCTTGGACAAGATGCTGGTCCCAGCAAGCTAGCAAAGATTCATTCGCACGGAATC
AAAACCATTGATGAAAATGGACTCTTTGACCTCATTAGAAAGCTGCCTGCATATGGCGGCAGCGGCAAGGGCGCT
CAAAAGGCACAGGAGAAGAAAAAGACTGAAGAGGAAAAGGTCAAGCGTCAAGTTGCAGAGATGGAAGCAGAGGAC
AAGGCAAACAAGGCAGCCGAAGCAAAACAGGCGCGCACAGCAGCAGCATCTGGGAGTGCCGCTGCGCCAGCGCGA
ACAACAGCTCAGCTCCTCACGTCAAAATACGCCCCTACGCAGATGAATCATCTGTGCGGCAACAAGGCGCATATT
GAGAAAATACAGACATGGCTCAGAAACTGGCCAAAATCGAAAAAGTATAACTTTCAGCGTCGCGGCGCCGACGGC
ATGGGTGGTGAGAGAGCCATCATCATCTCGGGGCCGCCCGGCATTGGAAAGACAACGGCGGCGCACTTGGCCGCC
AAGTTGGAAGGATACGACATCCTCGAGAGCAACGCCAGTGATACGAGGAGCAAGAAACTGGTCGAAGCTGGTGTC
AGTGATGCCATGAACAACACGTCGCTACGTGGCTTCTTTTCAGGCGACGGCAAGGCAGTGGATGCCACCAAGAAG
AAGCTTGTGCTCATCATGGACGAAGTGGATGGGATGTCTGCTGGCGATCGCGGCGGAGTCGGTGCCCTGGCCAAG
TTTTGCAGAAAGACAGAGGTGCCACTGATATTAATCTGCAACGAACGACGGCTTCCCAAGATGAAGCCCTTTGAC
CATGTGGCCTTTGACGTTCGCTTCAACCGGCCGACGACGGACCAGGTGCGATCTCGCATCATGACAATTTGCCAC
CGAGAAGGCCTCAAGTTGCCTCCACAGGTGATTGATGCGCTGATTGAAGGCAGCAACAAGGACATCCGACAAATC
ATCAACATGATTGCAACGGCCAAGCTGGACCAGACGAGCATGAACTACGATCAAGGCAAGGCCATGACCAAGGCC
TGGGAAAAGCACGTCATCCTCAAGCCCTGGGACATTTGCCAGAAGATATTGGGAGGCGGCCTGTTTGCGCCTGCC
AGCAAAGCCACGCTCAACGACAAGATCGAACTCTACTTCAATGACCACGAGTTCAGCTTCCTCATGATCCAAGAG
AACTATCTACGCACCAAGCCCATGTTGCTGAGCGGCAAGGGCTACACGAAGCGAGAAGAAAGAGTCAAGGCACTA
GAGCTCTTTGACCAGGCGGCAGAGAGCATTAGCGATGGCGACTTAGTGGACCGCATGATACACGGGCCACAGCAG
CACTGGAGCCTCATGCCCACGCACGCCGTCTTCAGCACGGTTCGTCCGGCCAGCTTTGTTGCTGGGCAGCTCGTG
GGCTCCGCATTTACCTCGTGGCTCGGCAACTTTAGCAAGACGGGCAAGCTGGGCCGATATGTGCGAGAGATTCAC
TCGCACATGCGCCTCAAGTCTTCGGGCGATCACAATGAAGTTCGGCAGCAGTATATGCCTCTGCTGTGGGATCGC
CTTGTCCATCGCCTACAGGTCGAGGGCACCGAGGCGGTTGAGCATGTCATTGGGCTCATGGATAGTTATTACCTT
ACGCGAGAAGACTTTGATGCTATTCAAGAGCTGGGCGTTGGCCCCATGGCGGAGGAGAATGTCAGGATCGAGACA
AAAACCAAGGCTTCATTTACAAGACAATACAACGCCATGAACCATCCGGTTCCATTTATCAAGGCCAGCAACGTC
TTGGCTCCAAAGGCACAGGCCAAGGAAGCCCCCGATCTCGAAGAAGCAATTGAAGAAGCAGACGACGCAGCAGAA
GTAGTTGAGGCGCCCGAAGCAGACGACGACGAACTCGATTTGAAAAAGGACAAGTACATCAAGGTACCCAAGGCC
AAAAAGGCAAGCAAGAAGCGCCAGGCGCCTGCAGCAGCAGATGATGAAGACGAAAAGCCCAAGGGGCGACCGAGG
GGGAAAAAGGCCAAGAAGTAA
Transcript >OphauG2|4352
ATGCCGGATATCAGATCCTTCTTCTCAGCCAAAGGCTCTACAGCCTCGAAACCGGCGCCTCCGAAAAAGGAGGCA
CTGTCCAATTCCAAAAGAGCGAGCCGAAAAGTTGTTCAGGACAGCGACGACGACGAGCCTGCCCCCGAGCAAACG
CCGGCAAAGGCAGCCTCGAAACCGGCCCCCAAGAAGAAAAAAAGCGATTTAGAGCCCGAAGGCATTCCAATATCC
GCTGAAGATTATTTTGCTTCGACTAAAGACGGCAAAAAGCGCCAAACAAAGTCGGCCCTGCCGACTGAGACCAAG
CCCTCACCTAAATCACAGCCTGCCGTACGGTCGAGCCCTCGCAAACATAAAACCACGGCCAAGACATCTGAACCA
GCTCCCAAAAGCGCTCTTTCTAAGAAAAAGACGGTTTCATATGAGCAGCATGAAGGCGCAGACGATGATGCTCAC
CTGTCGGAGGCAGAGCAAGGTGGACAGGACATATATGCGGCCGACTATCAAGGCGCAGGGAAGCGAATGCCCGAT
GATTATGTTGACAGCGCATCCGAGGAAGAGATCAAGCCCAAGACAAAACGTGTTTCCTCCCGAAAATCGAATACC
ACTTCAACAGGAGCCGCCGAAGAGCCTAAACCTGCCCGGCAGACTGCTGCTGCCTCAAAGAAGAAACGAAAATCG
CCGACATCAGATGACTCAGATGCCGAGGAATTGCCTCGAAAGAAGCTGACACCTGCCAAGCCACGAGCTCCTCGA
AAGAAGGCCGACGAGCCCGAAGACGAGAGTATTCAAAGCATACTAGACAGTGTTGCAACAGTTCGGCCGCCGACA
CCGCCACCCAAGGATCCAGCCGCCAAGTTTGACTGGAGAAAAGCTGGAGCAAGTGGAGGAAATGCCGCAGTCCAG
CCAATGCAATCTGCAGACCTGCCAGAAGGAGAAGAAGACTGCCTCATGGGGCTCTCGTTTGTCTTCACCGGCGTC
CTGCAAACGATTGGGCGCGACGAGGCACAGGCGCTGGTTAAGCGATACGGGGGCAAAGTAACAGGGCAGCCGAGC
ACCAAAACAAGCTTTGTCGTGCTTGGACAAGATGCTGGTCCCAGCAAGCTAGCAAAGATTCATTCGCACGGAATC
AAAACCATTGATGAAAATGGACTCTTTGACCTCATTAGAAAGCTGCCTGCATATGGCGGCAGCGGCAAGGGCGCT
CAAAAGGCACAGGAGAAGAAAAAGACTGAAGAGGAAAAGGTCAAGCGTCAAGTTGCAGAGATGGAAGCAGAGGAC
AAGGCAAACAAGGCAGCCGAAGCAAAACAGGCGCGCACAGCAGCAGCATCTGGGAGTGCCGCTGCGCCAGCGCGA
ACAACAGCTCAGCTCCTCACGTCAAAATACGCCCCTACGCAGATGAATCATCTGTGCGGCAACAAGGCGCATATT
GAGAAAATACAGACATGGCTCAGAAACTGGCCAAAATCGAAAAAGTATAACTTTCAGCGTCGCGGCGCCGACGGC
ATGGGTGGTGAGAGAGCCATCATCATCTCGGGGCCGCCCGGCATTGGAAAGACAACGGCGGCGCACTTGGCCGCC
AAGTTGGAAGGATACGACATCCTCGAGAGCAACGCCAGTGATACGAGGAGCAAGAAACTGGTCGAAGCTGGTGTC
AGTGATGCCATGAACAACACGTCGCTACGTGGCTTCTTTTCAGGCGACGGCAAGGCAGTGGATGCCACCAAGAAG
AAGCTTGTGCTCATCATGGACGAAGTGGATGGGATGTCTGCTGGCGATCGCGGCGGAGTCGGTGCCCTGGCCAAG
TTTTGCAGAAAGACAGAGGTGCCACTGATATTAATCTGCAACGAACGACGGCTTCCCAAGATGAAGCCCTTTGAC
CATGTGGCCTTTGACGTTCGCTTCAACCGGCCGACGACGGACCAGGTGCGATCTCGCATCATGACAATTTGCCAC
CGAGAAGGCCTCAAGTTGCCTCCACAGGTGATTGATGCGCTGATTGAAGGCAGCAACAAGGACATCCGACAAATC
ATCAACATGATTGCAACGGCCAAGCTGGACCAGACGAGCATGAACTACGATCAAGGCAAGGCCATGACCAAGGCC
TGGGAAAAGCACGTCATCCTCAAGCCCTGGGACATTTGCCAGAAGATATTGGGAGGCGGCCTGTTTGCGCCTGCC
AGCAAAGCCACGCTCAACGACAAGATCGAACTCTACTTCAATGACCACGAGTTCAGCTTCCTCATGATCCAAGAG
AACTATCTACGCACCAAGCCCATGTTGCTGAGCGGCAAGGGCTACACGAAGCGAGAAGAAAGAGTCAAGGCACTA
GAGCTCTTTGACCAGGCGGCAGAGAGCATTAGCGATGGCGACTTAGTGGACCGCATGATACACGGGCCACAGCAG
CACTGGAGCCTCATGCCCACGCACGCCGTCTTCAGCACGGTTCGTCCGGCCAGCTTTGTTGCTGGGCAGCTCGTG
GGCTCCGCATTTACCTCGTGGCTCGGCAACTTTAGCAAGACGGGCAAGCTGGGCCGATATGTGCGAGAGATTCAC
TCGCACATGCGCCTCAAGTCTTCGGGCGATCACAATGAAGTTCGGCAGCAGTATATGCCTCTGCTGTGGGATCGC
CTTGTCCATCGCCTACAGGTCGAGGGCACCGAGGCGGTTGAGCATGTCATTGGGCTCATGGATAGTTATTACCTT
ACGCGAGAAGACTTTGATGCTATTCAAGAGCTGGGCGTTGGCCCCATGGCGGAGGAGAATGTCAGGATCGAGACA
AAAACCAAGGCTTCATTTACAAGACAATACAACGCCATGAACCATCCGGTTCCATTTATCAAGGCCAGCAACGTC
TTGGCTCCAAAGGCACAGGCCAAGGAAGCCCCCGATCTCGAAGAAGCAATTGAAGAAGCAGACGACGCAGCAGAA
GTAGTTGAGGCGCCCGAAGCAGACGACGACGAACTCGATTTGAAAAAGGACAAGTACATCAAGGTACCCAAGGCC
AAAAAGGCAAGCAAGAAGCGCCAGGCGCCTGCAGCAGCAGATGATGAAGACGAAAAGCCCAAGGGGCGACCGAGG
GGGAAAAAGGCCAAGAAGTAA
Gene >OphauG2|4352
ATGCCGGATATCAGATCCTTCTTCTCAGCCAAAGGCTCTACAGCCTCGAAACCGGCGCCTCCGAAAAAGGAGGCA
CTGTCCAATTCCAAAAGAGCGAGTCAGTCTCATTGAACTTTAAGCTCCTTGACCCGGTTCTGACCCAGCTACCTT
AGGCCGAAAAGTTGTTCAGGACAGCGACGACGACGAGCCTGCCCCCGAGTAAGACTCATTTACGTGTTCCTGTTT
AAGTGAAATTCAAGCTGAGCTCTTAACAGGCAAACGCCGGCAAAGGCAGCCTCGAAACCGGCCCCCAAGAAGAAA
AAAAGGTTGGTAGTCAAGATGCAACCAATACGAAGTGTCACTGACAATATCACAGCGATTTAGAGCCCGAAGGCA
TTCCAATATCCGCTGAAGATTATTTTGCTTCGACTAAAGACGGCAAAAAGCGCCAAACAAAGTCGGCCCTGCCGA
CTGAGACCAAGCCCTCACCTAAATCACAGCCTGCCGTACGGTCGAGCCCTCGCAAACATAAAACCACGGCCAAGA
CATCTGAACCAGCTCCCAAAAGCGCTCTTTCTAAGAAAAAGACGGTTTCATATGAGCAGCATGAAGGCGCAGACG
ATGATGCTCACCTGTCGGAGGCAGAGCAAGGTGGACAGGACATATATGCGGCCGACTATCAAGGCGCAGGGAAGC
GAATGCCCGATGATTATGTTGACAGCGCATCCGAGGAAGAGATCAAGCCCAAGACAAAACGTGTTTCCTCCCGAA
AATCGAATACCACTTCAACAGGAGCCGCCGAAGAGCCTAAACCTGCCCGGCAGACTGCTGCTGCCTCAAAGAAGA
AACGAAAATCGCCGACATCAGATGACTCAGATGCCGAGGAATTGCCTCGAAAGAAGCTGACACCTGCCAAGCCAC
GAGCTCCTCGAAAGAAGGCCGACGAGCCCGAAGACGAGAGTATTCAAAGCATACTAGACAGTGTTGCAACAGTTC
GGCCGCCGACACCGCCACCCAAGGATCCAGCCGCCAAGTTTGACTGGAGAAAAGCTGGAGCAAGTGGAGGAAATG
CCGCAGTCCAGCCAATGCAATCTGCAGACCTGCCAGAAGGAGAAGAAGACTGCCTCATGGGGCTCTCGTTTGTCT
TCACCGGCGTCCTGCAAACGATTGGGCGCGACGAGGCACAGGCGCTGGTTAAGCGATACGGGGGCAAAGTAACAG
GGCAGCCGAGCACCAAAACAAGCTTTGTCGTGCTTGGACAAGATGCTGGTCCCAGCAAGCTAGCAAAGATTCATT
CGCACGGAATCAAAACCATTGATGAAAATGGACTCTTTGACCTCATTAGAAAGCTGCCTGCATATGGCGGCAGCG
GCAAGGGCGCTCAAAAGGCACAGGAGAAGAAAAAGACTGAAGAGGAAAAGGTCAAGCGTCAAGTTGCAGAGATGG
AAGCAGAGGACAAGGCAAACAAGGCAGCCGAAGCAAAACAGGCGCGCACAGCAGCAGCATCTGGGAGTGCCGCTG
CGCCAGCGCGAACAACAGCTCAGCTCCTCACGTCAAAATACGCCCCTACGCAGATGAATCATCTGTGCGGCAACA
AGGCGCATATTGAGAAAATACAGACATGGCTCAGAAACTGGCCAAAATCGAAAAAGTATAACTTTCAGCGTCGCG
GCGCCGACGGCATGGGTGGTGAGAGAGCCATCATCATCTCGGGGCCGCCCGGCATTGGAAAGACAACGGCGGCGC
ACTTGGCCGCCAAGTTGGAAGGATACGACATCCTCGAGAGCAACGCCAGTGATACGAGGAGCAAGAAACTGGTCG
AAGCTGGTGTCAGTGATGCCATGAACAACACGTCGCTACGTGGCTTCTTTTCAGGCGACGGCAAGGCAGTGGATG
CCACCAAGAAGAAGCTTGTGCTCATCATGGACGAAGTGGATGGGATGTCTGCTGGCGATCGCGGCGGAGTCGGTG
CCCTGGCCAAGTTTTGCAGAAAGACAGAGGTGCCACTGATATTAATCTGCAACGAACGACGGCTTCCCAAGATGA
AGCCCTTTGACCATGTGGCCTTTGACGTTCGCTTCAACCGGCCGACGACGGACCAGGTGCGATCTCGCATCATGA
CAATTTGCCACCGAGAAGGCCTCAAGTTGCCTCCACAGGTGATTGATGCGCTGATTGAAGGCAGCAACAAGGACA
TCCGACAAATCATCAACATGATTGCAACGGCCAAGCTGGACCAGACGAGCATGAACTACGATCAAGGCAAGGCCA
TGACCAAGGCCTGGGAAAAGCACGTCATCCTCAAGCCCTGGGACATTTGCCAGAAGATATTGGGAGGCGGCCTGT
TTGCGCCTGCCAGCAAAGCCACGCTCAACGACAAGATCGAACTCTACTTCAATGACCACGAGTTCAGCTTCCTCA
TGATCCAAGAGAACTATCTACGCACCAAGCCCATGTTGCTGAGCGGCAAGGGCTACACGAAGCGAGAAGAAAGAG
TCAAGGCACTAGAGCTCTTTGACCAGGCGGCAGAGAGCATTAGCGATGGCGACTTAGTGGACCGCATGATACACG
GGCCACAGCAGCACTGGAGCCTCATGCCCACGCACGCCGTCTTCAGCACGGTTCGTCCGGCCAGCTTTGTTGCTG
GGCAGCTCGTGGGCTCCGCATTTACCTCGTGGCTCGGCAACTTTAGCAAGACGGGCAAGCTGGGCCGATATGTGC
GAGAGATTCACTCGCACATGCGCCTCAAGTCTTCGGGCGATCACAATGAAGTTCGGCAGCAGTATATGCCTCTGC
TGTGGGATCGCCTTGTCCATCGCCTACAGGTCGAGGGCACCGAGGCGGTTGAGCATGTCATTGGGCTCATGGATA
GTTATTACCTTACGCGAGAAGACTTTGATGCTATTCAAGAGCTGGGCGTTGGCCCCATGGCGGAGGAGAATGTCA
GGATCGAGACAAAAACCAAGGCTTCATTTACAAGACAGTGAGTACAGGCTCTGTTTTTTTTTCCTATTCTTTTGT
CACGAGCCCTTTCATTGCCACTGAGGTGAGAGAAAGCCAAAGCTAATTAGGATACAGATACAACGCCATGAACCA
TCCGGTTCCATTTATCAAGGCCAGCAACGTCTTGGCTCCAAAGGCACAGGCCAAGGAAGCCCCCGATCTCGAAGA
AGCAATTGAAGAAGCAGACGACGCAGCAGAAGTAGTTGAGGCGCCCGAAGCAGACGACGACGAACTCGATTTGAA
AAAGGACAAGTACATCAAGGTACCCAAGGCCAAAAAGGCAAGCAAGAAGCGCCAGGCGCCTGCAGCAGCAGATGA
TGAAGACGAAAAGCCCAAGGGGCGACCGAGGGGGAAAAAGGCCAAGAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail