Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4350
Gene name
LocationContig_36:31225..33500
Strand-
Gene length (bp)2275
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 2.8E-97 40 457
PF00686 CBM_20 Starch binding domain 7.7E-29 531 622

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36914|AMYG_ASPOR Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=glaA PE=2 SV=2 30 630 0.0E+00
sp|P14804|AMYG_NEUCR Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gla-1 PE=1 SV=3 1 630 0.0E+00
sp|P23176|AMYG_ASPKA Glucoamylase I OS=Aspergillus kawachii GN=gaI PE=1 SV=1 28 630 0.0E+00
sp|P22832|AMYG_ASPSH Glucoamylase OS=Aspergillus shirousami GN=glaA PE=3 SV=1 28 630 0.0E+00
sp|P69327|AMYG_ASPAW Glucoamylase OS=Aspergillus awamori GN=GLAA PE=1 SV=1 28 630 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36914|AMYG_ASPOR Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=glaA PE=2 SV=2 30 630 0.0E+00
sp|P14804|AMYG_NEUCR Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gla-1 PE=1 SV=3 1 630 0.0E+00
sp|P23176|AMYG_ASPKA Glucoamylase I OS=Aspergillus kawachii GN=gaI PE=1 SV=1 28 630 0.0E+00
sp|P22832|AMYG_ASPSH Glucoamylase OS=Aspergillus shirousami GN=glaA PE=3 SV=1 28 630 0.0E+00
sp|P69327|AMYG_ASPAW Glucoamylase OS=Aspergillus awamori GN=GLAA PE=1 SV=1 28 630 0.0E+00
sp|P69328|AMYG_ASPNG Glucoamylase OS=Aspergillus niger GN=GLAA PE=1 SV=1 28 630 0.0E+00
sp|P0DN29|AMYG_ARTBC Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-1 PE=1 SV=1 6 630 7.0E-178
sp|D8Q9M3|AMYG_SCHCM Glucoamylase ARB_02327-1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_57589 PE=1 SV=1 28 630 3.0E-177
sp|Q03045|AMYG_AMORE Glucoamylase P OS=Amorphotheca resinae GN=GAMP PE=1 SV=1 30 630 6.0E-176
sp|O60087|AMYG_SCHPO Probable glucoamylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu17 PE=2 SV=1 28 463 2.0E-86
sp|I1BYW6|AMYD_RHIO9 Glucoamylase amyD OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=amyD PE=1 SV=1 3 462 9.0E-68
sp|P07683|AMYG_RHIOR Glucoamylase 1 OS=Rhizopus oryzae PE=1 SV=2 27 462 2.0E-66
sp|P26989|AMYH_SACFI Glucoamylase GLA1 OS=Saccharomycopsis fibuligera GN=GLA1 PE=3 SV=2 30 463 3.0E-66
sp|P08017|AMYG_SACFI Glucoamylase GLU1 OS=Saccharomycopsis fibuligera GN=GLU1 PE=1 SV=1 30 463 5.0E-64
sp|P42042|AMYG_BLAAD Glucoamylase OS=Blastobotrys adeninivorans GN=GAA PE=3 SV=1 35 463 3.0E-63
sp|P08019|AMYG_YEAST Glucoamylase, intracellular sporulation-specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGA1 PE=3 SV=2 28 464 3.0E-58
sp|P04065|AMYH_YEASX Glucoamylase S1 OS=Saccharomyces cerevisiae GN=STA1 PE=3 SV=2 28 368 2.0E-48
sp|P29760|AMYI_YEASX Glucoamylase S2 OS=Saccharomyces cerevisiae GN=STA2 PE=3 SV=1 30 368 4.0E-48
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 514 624 2.0E-12
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 510 622 5.0E-12
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 529 618 7.0E-12
sp|P30270|AMY_STRGR Alpha-amylase OS=Streptomyces griseus GN=amy PE=3 SV=1 531 630 7.0E-12
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 531 630 7.0E-12
sp|P19584|AMYB_THETU Thermophilic beta-amylase OS=Thermoanaerobacterium thermosulfurigenes PE=1 SV=1 532 616 5.0E-11
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 530 631 2.0E-10
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 518 622 4.0E-10
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 497 631 1.0E-09
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 499 622 3.0E-09
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 531 622 2.0E-07
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 531 622 5.0E-07
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 531 631 6.0E-07
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 514 631 1.0E-06
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 531 622 1.0E-06
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 525 622 2.0E-06
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 525 622 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:2001070 starch binding Yes
GO:0003674 molecular_function No
GO:0030247 polysaccharide binding No
GO:0005488 binding No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4350
MHFISTALLFTSVTWQHVVGQAASPLNASVDAFLESEAPIALELLLCNIGAQGCHVKGAASGVVVASPSTHDPDY
FYTWTRDSALVFKSLVDRFTHNYDASLQHHIQEYIVSQAAQQAVSNPSGSLADGTGLGEPKFQVNLTAFTGEWGR
PQRDGPPLRAIAMISYANWLIQNGYTSTVSSIIWPVVQNDLNYVAQYWNETGFDLWEEVNGSSFFTTLNQYRALV
EGSQLAAALGQPSESYQHVAPQILCFLQGYWMPSQGYINANIHHNKERTGKDVNTLLGSIHVFDAKLGCDATTFQ
PCSDKALSNLKSTVDSFRSYPINRGIASGKAIALGRYIEDVYYHGNPWYLTTLAAAEALYDSLHVWKQSGSLTVT
SRSLAFFQDLLPATAPGTYSKDSQMFDAIVDAVAAYADGFVDVVARYVGPQGSLAEQFTKDTGRPTSARHLTWSY
ASLLTAAARRSGIVPPSWLNGAPVSVPDTCSATSVRGTYAPATATSFPPSQTPRTGRPPNPTTGVSPSPTSSQCS
VPTSASVTFKVLAPTEWGQNVKIVGNVGALGNWNPYKAVALDSSEYTPLTPVWKTTLSFTPGDGLEYKYIKVASN
GAIEWEHDPNHTYTVPKTCATTHLRTDAWQS*
Coding >OphauG2|4350
ATGCACTTCATCTCGACTGCTCTCCTCTTTACCTCTGTCACCTGGCAGCACGTCGTGGGCCAGGCGGCCAGTCCA
CTCAACGCCAGTGTCGATGCCTTTCTCGAGTCGGAGGCGCCCATTGCTTTGGAACTGCTGCTTTGCAACATTGGA
GCCCAGGGCTGCCATGTAAAGGGCGCTGCCTCTGGAGTCGTTGTTGCGTCTCCCAGCACCCATGATCCAGACTAC
TTTTACACATGGACCAGAGACAGCGCCCTCGTCTTCAAGTCGCTCGTTGACCGCTTCACTCACAACTATGACGCC
AGTCTTCAGCACCACATCCAAGAGTACATTGTCTCTCAGGCGGCACAACAGGCCGTCTCCAACCCGTCCGGCTCG
CTGGCCGATGGCACCGGTCTAGGAGAGCCAAAGTTTCAAGTCAATCTAACCGCCTTTACTGGCGAATGGGGCCGT
CCCCAGAGAGACGGGCCGCCTCTAAGGGCCATTGCCATGATTTCATATGCCAACTGGCTTATTCAAAATGGCTAC
ACCTCAACCGTTTCGTCTATTATTTGGCCAGTTGTGCAAAACGACCTCAACTATGTCGCACAGTACTGGAATGAA
ACCGGGTTTGACCTGTGGGAAGAGGTCAATGGCTCTTCCTTTTTTACTACTCTAAACCAATACCGAGCCTTGGTC
GAGGGCAGTCAACTCGCCGCGGCTCTTGGACAGCCCAGCGAGTCGTATCAACATGTCGCACCCCAGATCCTTTGC
TTCCTCCAGGGCTACTGGATGCCGTCTCAAGGCTACATCAACGCAAACATCCACCACAACAAGGAGCGCACCGGC
AAAGACGTCAACACGCTGCTCGGCTCCATTCACGTTTTTGACGCCAAGCTGGGCTGCGACGCCACCACCTTCCAG
CCCTGCAGCGACAAGGCTCTATCCAACCTCAAGAGCACCGTCGACTCGTTCCGCAGCTACCCCATCAACAGAGGC
ATCGCCAGCGGCAAAGCCATTGCGCTGGGCCGGTACATCGAGGATGTCTACTACCATGGCAATCCGTGGTACTTG
ACCACCCTAGCCGCCGCAGAGGCTCTCTATGACTCTCTCCACGTCTGGAAGCAGTCTGGCTCTCTGACCGTCACC
AGTCGCTCTCTCGCCTTCTTCCAGGACCTGCTCCCCGCTACTGCCCCAGGCACCTACTCCAAAGACAGCCAGATG
TTTGATGCCATTGTGGATGCAGTCGCCGCCTATGCCGATGGCTTCGTCGACGTCGTCGCGCGCTACGTCGGCCCT
CAGGGCTCCCTGGCAGAGCAGTTCACCAAGGACACTGGCCGTCCCACCTCTGCCCGCCATCTCACATGGTCTTAC
GCATCACTGCTCACCGCTGCTGCCCGTCGCTCTGGCATTGTCCCCCCGTCGTGGCTCAACGGCGCACCTGTGTCT
GTGCCCGATACCTGCTCGGCAACCTCTGTCCGCGGTACATATGCCCCTGCTACAGCCACCTCGTTTCCCCCGTCG
CAAACTCCAAGGACGGGCCGCCCACCAAATCCCACCACTGGCGTCTCACCCTCGCCAACTTCCAGCCAGTGCTCC
GTGCCAACTTCTGCTAGCGTCACCTTCAAAGTTCTTGCTCCCACCGAGTGGGGACAGAATGTCAAGATCGTCGGC
AACGTCGGCGCCTTGGGCAACTGGAACCCCTACAAGGCCGTGGCCCTTGATTCGTCCGAATACACTCCCCTGACG
CCTGTCTGGAAGACGACTCTGTCCTTCACTCCAGGCGATGGCCTCGAGTACAAATACATCAAGGTTGCATCCAAT
GGCGCCATTGAATGGGAACATGATCCCAACCATACATACACGGTGCCCAAGACTTGTGCTACTACCCATCTTCGC
ACGGATGCTTGGCAGTCGTAG
Transcript >OphauG2|4350
ATGCACTTCATCTCGACTGCTCTCCTCTTTACCTCTGTCACCTGGCAGCACGTCGTGGGCCAGGCGGCCAGTCCA
CTCAACGCCAGTGTCGATGCCTTTCTCGAGTCGGAGGCGCCCATTGCTTTGGAACTGCTGCTTTGCAACATTGGA
GCCCAGGGCTGCCATGTAAAGGGCGCTGCCTCTGGAGTCGTTGTTGCGTCTCCCAGCACCCATGATCCAGACTAC
TTTTACACATGGACCAGAGACAGCGCCCTCGTCTTCAAGTCGCTCGTTGACCGCTTCACTCACAACTATGACGCC
AGTCTTCAGCACCACATCCAAGAGTACATTGTCTCTCAGGCGGCACAACAGGCCGTCTCCAACCCGTCCGGCTCG
CTGGCCGATGGCACCGGTCTAGGAGAGCCAAAGTTTCAAGTCAATCTAACCGCCTTTACTGGCGAATGGGGCCGT
CCCCAGAGAGACGGGCCGCCTCTAAGGGCCATTGCCATGATTTCATATGCCAACTGGCTTATTCAAAATGGCTAC
ACCTCAACCGTTTCGTCTATTATTTGGCCAGTTGTGCAAAACGACCTCAACTATGTCGCACAGTACTGGAATGAA
ACCGGGTTTGACCTGTGGGAAGAGGTCAATGGCTCTTCCTTTTTTACTACTCTAAACCAATACCGAGCCTTGGTC
GAGGGCAGTCAACTCGCCGCGGCTCTTGGACAGCCCAGCGAGTCGTATCAACATGTCGCACCCCAGATCCTTTGC
TTCCTCCAGGGCTACTGGATGCCGTCTCAAGGCTACATCAACGCAAACATCCACCACAACAAGGAGCGCACCGGC
AAAGACGTCAACACGCTGCTCGGCTCCATTCACGTTTTTGACGCCAAGCTGGGCTGCGACGCCACCACCTTCCAG
CCCTGCAGCGACAAGGCTCTATCCAACCTCAAGAGCACCGTCGACTCGTTCCGCAGCTACCCCATCAACAGAGGC
ATCGCCAGCGGCAAAGCCATTGCGCTGGGCCGGTACATCGAGGATGTCTACTACCATGGCAATCCGTGGTACTTG
ACCACCCTAGCCGCCGCAGAGGCTCTCTATGACTCTCTCCACGTCTGGAAGCAGTCTGGCTCTCTGACCGTCACC
AGTCGCTCTCTCGCCTTCTTCCAGGACCTGCTCCCCGCTACTGCCCCAGGCACCTACTCCAAAGACAGCCAGATG
TTTGATGCCATTGTGGATGCAGTCGCCGCCTATGCCGATGGCTTCGTCGACGTCGTCGCGCGCTACGTCGGCCCT
CAGGGCTCCCTGGCAGAGCAGTTCACCAAGGACACTGGCCGTCCCACCTCTGCCCGCCATCTCACATGGTCTTAC
GCATCACTGCTCACCGCTGCTGCCCGTCGCTCTGGCATTGTCCCCCCGTCGTGGCTCAACGGCGCACCTGTGTCT
GTGCCCGATACCTGCTCGGCAACCTCTGTCCGCGGTACATATGCCCCTGCTACAGCCACCTCGTTTCCCCCGTCG
CAAACTCCAAGGACGGGCCGCCCACCAAATCCCACCACTGGCGTCTCACCCTCGCCAACTTCCAGCCAGTGCTCC
GTGCCAACTTCTGCTAGCGTCACCTTCAAAGTTCTTGCTCCCACCGAGTGGGGACAGAATGTCAAGATCGTCGGC
AACGTCGGCGCCTTGGGCAACTGGAACCCCTACAAGGCCGTGGCCCTTGATTCGTCCGAATACACTCCCCTGACG
CCTGTCTGGAAGACGACTCTGTCCTTCACTCCAGGCGATGGCCTCGAGTACAAATACATCAAGGTTGCATCCAAT
GGCGCCATTGAATGGGAACATGATCCCAACCATACATACACGGTGCCCAAGACTTGTGCTACTACCCATCTTCGC
ACGGATGCTTGGCAGTCGTAG
Gene >OphauG2|4350
ATGCACTTCATCTCGACTGCTCTCCTCTTTACCTCTGTCACCTGGCAGCACGTCGTGGGCCAGGCGGCCAGTCCA
CTCAACGCCAGTGTCGATGCCTTTCTCGAGTCGGAGGCGCCCATTGCTTTGGAACTGCTGCTTTGCAACATTGGA
GCCCAGGGCTGCCATGTAAAGGGCGCTGCCTCTGGAGTCGTTGTTGCGTCTCCCAGCACCCATGATCCAGACTGT
CCGTGACGTCTTTTTTTTTTGTTTTTTTCTTCATCCTTCTTCTATTGTCTCCTGTTTGCTTGCTAGATGGATGGA
TACCAGGCTTCATCATTATTAAAGATATAAATGCTCAACTGGTCTCGACAGACTTTTACACATGGACCAGAGACA
GCGCCCTCGTCTTCAAGTCGCTCGTTGACCGCTTCACTCACAACTATGACGCCAGTCTTCAGCACCACATCCAAG
AGTACATTGTCTCTCAGGCGGCACAACAGGCCGTCTCCAACCCGTCCGGCTCGCTGGCCGATGGCACCGGTCTAG
GAGAGCCAAAGTTTCAAGTCAATCTAACCGCCTTTACTGGCGAATGGGGCAAGTACTCAGCCCAAGGAGAAAAAA
CGGTACAGCTTGTGCAAAAAGCAAGGCTCAAAGGACTAACACCTGTGTCTATTCTGTAGGCCGTCCCCAGAGAGA
CGGGCCGCCTCTAAGGGCCATTGCCATGATTTCATATGCCAACTGGCTTATTCAAAATGGCTACACCTCAACCGT
TTCGTCTATTATTTGGCCAGTTGTGCAAAACGACCTCAACTATGTCGCACAGTACTGGTCAGTGGCTGGCTAACA
AGCCATCCAGACTAATACGAGCTGACGCCTTGGTCTAGGAATGAAACCGGGTTTGACCTGTGGGAAGAGGTCAAT
GGCTCTTCCTTTTTTACTACTCTAAACCAATACCGAGGTATCCTTTTCATCCATCACATCACATGCAGCAGCCTT
TCTGACCCTTAGTTTCTTAGCCTTGGTCGAGGGCAGTCAACTCGCCGCGGCTCTTGGACAGCCCAGCGAGTCGTA
TCAACATGTCGCACCCCAGATCCTTTGCTTCCTCCAGGGCTACTGGATGCCGTCTCAAGGCTACATCAACGCAAA
CAGTCAGTATTTGCAGACATTATCTCTCGACTCACAGCCACTAATCTTGTCAGTCCACCACAACAAGGAGCGCAC
CGGCAAAGACGTCAACACGCTGCTCGGCTCCATTCACGTTTTTGACGCCAAGCTGGGCTGCGACGCCACCACCTT
CCAGCCCTGCAGCGACAAGGCTCTATCCAACCTCAAGAGCACCGTCGACTCGTTCCGCAGCTACCCCATCAACAG
AGGCATCGCCAGCGGCAAAGCCATTGCGCTGGGCCGGTACATCGAGGATGTCTACTACCATGGCAATCCGTGGTA
CTTGACCACCCTAGCCGCCGCAGAGGCTCTCTATGACTCTCTCCACGTCTGGAAGCAGTCTGGCTCTCTGACCGT
CACCAGTCGCTCTCTCGCCTTCTTCCAGGACCTGCTCCCCGCTACTGCCCCAGGCACCTACTCCAAAGACAGCCA
GATGTTTGATGCCATTGTGGATGCAGTCGCCGCCTATGCCGATGGCTTCGTCGACGTCGTCGCGCGCTACGTCGG
CCCTCAGGGCTCCCTGGCAGAGCAGTTCACCAAGGACACTGGCCGTCCCACCTCTGCCCGCCATCTCACATGGTC
TTACGCATCACTGCTCACCGCTGCTGCCCGTCGCTCTGGCATTGTCCCCCCGTCGTGGCTCAACGGCGCACCTGT
GTCTGTGCCCGATACCTGCTCGGCAACCTCTGTCCGCGGTACATATGCCCCTGCTACAGCCACCTCGTTTCCCCC
GTCGCAAACTCCAAGGACGGGCCGCCCACCAAATCCCACCACTGGCGTCTCACCCTCGCCAACTTCCAGCCAGTG
CTCCGTGCCAACTTCTGCTAGCGTCACCTTCAAAGTTCTTGCTCCCACCGAGTGGGGACAGAATGTCAAGATCGT
CGGCAACGTCGGCGCCTTGGGCAACTGGAACCCCTACAAGGCCGTGGCCCTTGATTCGTCCGAATACACTCCCCT
GACGCCTGTCTGGAAGACGACTCTGTCCTTCACTCCAGGCGATGGCCTCGAGTACAAATACATCAAGGTTGCATC
CAATGGCGCCATTGAATGGGAACATGATCCCAACCATACATACACGGTGCCCAAGACTTGTGCTACTACCCATCT
TCGCACGGATGCTTGGCAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail