Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4349
Gene name
LocationContig_36:28583..31103
Strand+
Gene length (bp)2520
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00750 tRNA-synt_1d tRNA synthetases class I (R) 1.3E-95 149 504
PF05746 DALR_1 DALR anticodon binding domain 8.0E-28 519 636

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05506|SYRC_YEAST Arginine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR341C PE=1 SV=1 5 636 0.0E+00
sp|O74781|SYRC_SCHPO Probable arginine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrs1 PE=2 SV=1 31 636 0.0E+00
sp|P38714|SYRM_YEAST Arginine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSR1 PE=3 SV=3 30 636 0.0E+00
sp|Q558Z0|SYRC_DICDI Probable arginine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=argS1 PE=3 SV=1 35 636 6.0E-160
sp|Q3U186|SYRM_MOUSE Probable arginine--tRNA ligase, mitochondrial OS=Mus musculus GN=Rars2 PE=1 SV=1 141 636 1.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05506|SYRC_YEAST Arginine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR341C PE=1 SV=1 5 636 0.0E+00
sp|O74781|SYRC_SCHPO Probable arginine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrs1 PE=2 SV=1 31 636 0.0E+00
sp|P38714|SYRM_YEAST Arginine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSR1 PE=3 SV=3 30 636 0.0E+00
sp|Q558Z0|SYRC_DICDI Probable arginine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=argS1 PE=3 SV=1 35 636 6.0E-160
sp|Q3U186|SYRM_MOUSE Probable arginine--tRNA ligase, mitochondrial OS=Mus musculus GN=Rars2 PE=1 SV=1 141 636 1.0E-120
sp|Q8SRD8|SYR_ENCCU Arginine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0550 PE=1 SV=1 78 636 7.0E-120
sp|Q0P5H7|SYRM_BOVIN Probable arginine--tRNA ligase, mitochondrial OS=Bos taurus GN=RARS2 PE=2 SV=1 119 636 1.0E-118
sp|Q6GQJ7|SYRM_XENLA Probable arginine--tRNA ligase, mitochondrial OS=Xenopus laevis GN=rars2 PE=2 SV=1 141 636 2.0E-118
sp|Q5T160|SYRM_HUMAN Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens GN=RARS2 PE=1 SV=1 119 636 7.0E-116
sp|Q5REH3|SYRM_PONAB Probable arginine--tRNA ligase, mitochondrial OS=Pongo abelii GN=RARS2 PE=2 SV=1 119 636 1.0E-115
sp|B8CWA9|SYR_HALOH Arginine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=argS PE=3 SV=1 62 636 1.0E-107
sp|Q896N5|SYR_CLOTE Arginine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=argS PE=3 SV=1 36 636 2.0E-103
sp|Q54869|SYR_STRPN Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=argS PE=1 SV=2 30 636 6.0E-101
sp|C1CTY4|SYR_STRZT Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=argS PE=3 SV=1 30 636 1.0E-100
sp|C1CH08|SYR_STRZJ Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=argS PE=3 SV=1 30 636 1.0E-100
sp|Q8DN69|SYR_STRR6 Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=argS PE=3 SV=1 30 636 1.0E-100
sp|B8ZPK2|SYR_STRPJ Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=argS PE=3 SV=1 30 636 1.0E-100
sp|Q04I94|SYR_STRP2 Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=argS PE=3 SV=1 30 636 1.0E-100
sp|B2IMZ8|SYR_STRPS Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=argS PE=3 SV=1 30 636 1.0E-100
sp|C1CN25|SYR_STRZP Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=argS PE=3 SV=1 30 636 2.0E-100
sp|C1CAQ7|SYR_STRP7 Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=argS PE=3 SV=1 30 636 2.0E-100
sp|B5E387|SYR_STRP4 Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=argS PE=3 SV=1 30 636 3.0E-100
sp|B1I9E7|SYR_STRPI Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=argS PE=3 SV=1 30 636 3.0E-100
sp|A6TNX2|SYR_ALKMQ Arginine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argS PE=3 SV=1 47 636 4.0E-100
sp|Q189Q7|SYR_PEPD6 Arginine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=argS PE=3 SV=1 36 636 8.0E-100
sp|B1YFI1|SYR_EXIS2 Arginine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argS PE=3 SV=1 36 636 3.0E-99
sp|Q97K78|SYR_CLOAB Arginine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argS PE=3 SV=1 36 636 3.0E-99
sp|Q1WU48|SYR_LACS1 Arginine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=argS PE=3 SV=1 62 636 4.0E-99
sp|Q63C01|SYR1_BACCZ Arginine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=argS1 PE=3 SV=1 62 636 1.0E-98
sp|Q88X53|SYR_LACPL Arginine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argS PE=3 SV=1 62 636 2.0E-98
sp|Q6HJF5|SYR1_BACHK Arginine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argS1 PE=3 SV=1 36 636 5.0E-98
sp|Q81R81|SYR2_BACAN Arginine--tRNA ligase 2 OS=Bacillus anthracis GN=argS2 PE=3 SV=1 62 636 9.0E-98
sp|C0MGC8|SYR_STRS7 Arginine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=argS PE=3 SV=1 50 636 8.0E-97
sp|A4VYA3|SYR_STRSY Arginine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=argS PE=3 SV=1 55 636 1.0E-95
sp|A4W4J9|SYR_STRS2 Arginine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=argS PE=3 SV=1 55 636 1.0E-95
sp|C0MAS8|SYR_STRE4 Arginine--tRNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=argS PE=3 SV=1 50 636 2.0E-95
sp|Q9CE12|SYR_LACLA Arginine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argS PE=3 SV=1 40 636 6.0E-95
sp|A5N8F9|SYR_CLOK5 Arginine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=argS PE=3 SV=1 62 636 9.0E-95
sp|B9E1W5|SYR_CLOK1 Arginine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=argS PE=3 SV=1 62 636 9.0E-95
sp|Q8DRW2|SYR_STRMU Arginine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argS PE=3 SV=1 101 636 1.0E-94
sp|A2RNI8|SYR_LACLM Arginine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argS PE=3 SV=1 40 636 4.0E-94
sp|Q02W95|SYR_LACLS Arginine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=argS PE=3 SV=1 40 636 8.0E-94
sp|Q5FIQ9|SYR_LACAC Arginine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=argS PE=3 SV=1 106 636 9.0E-94
sp|Q74KR5|SYR_LACJO Arginine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=argS PE=3 SV=1 106 636 2.0E-93
sp|Q03GE2|SYR_PEDPA Arginine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=argS PE=3 SV=1 53 636 4.0E-93
sp|B1IIE6|SYR_CLOBK Arginine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=argS PE=3 SV=1 36 636 5.0E-93
sp|B1KYT1|SYR_CLOBM Arginine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=argS PE=3 SV=1 36 636 5.0E-93
sp|Q8XJU2|SYR_CLOPE Arginine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=argS PE=3 SV=1 62 636 7.0E-93
sp|C4L0Z5|SYR_EXISA Arginine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=argS PE=3 SV=1 99 636 3.0E-92
sp|A7GCB9|SYR_CLOBL Arginine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=argS PE=3 SV=1 36 636 3.0E-92
sp|C1FK28|SYR_CLOBJ Arginine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=argS PE=3 SV=1 36 636 1.0E-91
sp|C3KSZ0|SYR_CLOB6 Arginine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=argS PE=3 SV=1 36 636 1.0E-91
sp|Q1J486|SYR_STRPF Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=argS PE=3 SV=1 50 636 1.0E-91
sp|Q5X9F1|SYR_STRP6 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=argS PE=3 SV=1 50 636 2.0E-91
sp|P0DG27|SYR_STRPQ Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=argS PE=3 SV=1 50 636 2.0E-91
sp|P0DG26|SYR_STRP3 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=argS PE=3 SV=1 50 636 2.0E-91
sp|B9DW76|SYR_STRU0 Arginine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=argS PE=3 SV=1 41 636 3.0E-91
sp|A5I0R5|SYR_CLOBH Arginine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=argS PE=3 SV=1 36 636 3.0E-91
sp|A7FSW7|SYR_CLOB1 Arginine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=argS PE=3 SV=1 36 636 3.0E-91
sp|B2UW74|SYR_CLOBA Arginine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=argS PE=3 SV=1 36 636 5.0E-91
sp|Q8NZ22|SYR_STRP8 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=argS PE=3 SV=1 50 636 5.0E-91
sp|A2RGX5|SYR_STRPG Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=argS PE=3 SV=1 50 636 8.0E-91
sp|Q1JJG7|SYR_STRPC Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=argS PE=3 SV=1 50 636 8.0E-91
sp|Q99XL5|SYR_STRP1 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=argS PE=3 SV=1 50 636 8.0E-91
sp|Q03MY7|SYR_STRTD Arginine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=argS PE=3 SV=1 62 636 2.0E-90
sp|Q5M1Z3|SYR_STRT1 Arginine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argS PE=3 SV=1 62 636 2.0E-90
sp|Q48QT3|SYR_STRPM Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=argS PE=3 SV=1 50 636 2.0E-90
sp|Q1JEG8|SYR_STRPD Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=argS PE=3 SV=1 50 636 2.0E-90
sp|A6LS73|SYR_CLOB8 Arginine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=argS PE=3 SV=1 101 636 2.0E-90
sp|Q38VQ9|SYR_LACSS Arginine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=argS PE=3 SV=1 62 636 4.0E-90
sp|Q1J9B9|SYR_STRPB Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=argS PE=3 SV=1 50 636 5.0E-90
sp|Q5M6I4|SYR_STRT2 Arginine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argS PE=3 SV=1 62 636 7.0E-90
sp|Q8DWV9|SYR_STRA5 Arginine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=argS PE=3 SV=1 47 636 7.0E-90
sp|Q3JYM1|SYR_STRA1 Arginine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=argS PE=3 SV=1 47 636 8.0E-90
sp|B1MZ82|SYR_LEUCK Arginine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=argS PE=3 SV=1 37 636 9.0E-90
sp|Q8E2R1|SYR_STRA3 Arginine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=argS PE=3 SV=1 47 636 3.0E-89
sp|Q03WV9|SYR_LEUMM Arginine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=argS PE=3 SV=1 101 636 5.0E-88
sp|Q03QD4|SYR_LACBA Arginine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=argS PE=3 SV=1 36 636 2.0E-87
sp|Q04B18|SYR_LACDB Arginine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=argS PE=3 SV=1 101 636 2.0E-87
sp|Q1GAN1|SYR_LACDA Arginine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=argS PE=3 SV=1 76 636 3.0E-87
sp|B5XJ77|SYR_STRPZ Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=argS PE=3 SV=1 50 636 8.0E-87
sp|Q831N1|SYR_ENTFA Arginine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=argS PE=3 SV=1 40 636 2.0E-86
sp|Q04FF6|SYR_OENOB Arginine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=argS PE=3 SV=1 106 636 4.0E-86
sp|B2GDD7|SYR_LACF3 Arginine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=argS PE=3 SV=1 101 636 4.0E-85
sp|Q9KEL8|SYR2_BACHD Arginine--tRNA ligase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argS2 PE=3 SV=1 148 636 1.0E-82
sp|B2G8D8|SYR_LACRJ Arginine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=argS PE=3 SV=1 83 636 3.0E-77
sp|A5VL03|SYR_LACRD Arginine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=argS PE=3 SV=1 83 636 3.0E-77
sp|Q8RG14|SYR_FUSNN Arginine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=argS PE=3 SV=1 34 636 8.0E-75
sp|A1SQW6|SYR_PSYIN Arginine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=argS PE=3 SV=1 37 636 2.0E-69
sp|Q9HHN2|SYR_HALSA Arginine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=argS PE=3 SV=1 100 636 1.0E-66
sp|Q7NWM1|SYR_CHRVO Arginine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argS PE=3 SV=1 154 636 2.0E-65
sp|Q7URC7|SYR_RHOBA Arginine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argS PE=3 SV=1 34 636 2.0E-65
sp|B8G4J9|SYR_CHLAD Arginine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=argS PE=3 SV=1 95 636 1.0E-64
sp|A5UCH1|SYR_HAEIE Arginine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=argS PE=3 SV=1 83 636 7.0E-64
sp|Q0VMA8|SYR_ALCBS Arginine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=argS PE=3 SV=1 70 636 1.0E-63
sp|Q4QL12|SYR_HAEI8 Arginine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=argS PE=3 SV=1 83 636 3.0E-63
sp|P43832|SYR_HAEIN Arginine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=argS PE=3 SV=1 83 636 8.0E-63
sp|Q87V03|SYR_PSESM Arginine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argS PE=3 SV=1 82 636 9.0E-63
sp|Q4ZZF5|SYR_PSEU2 Arginine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argS PE=3 SV=1 82 636 1.0E-62
sp|Q15W53|SYR_PSEA6 Arginine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=argS PE=3 SV=1 79 636 2.0E-62
sp|Q8KPU9|SYR_SYNE7 Arginine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=argS PE=3 SV=2 59 636 3.0E-62
sp|Q55486|SYR_SYNY3 Arginine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argS PE=3 SV=1 39 636 4.0E-62
sp|C1D5W4|SYR_LARHH Arginine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=argS PE=3 SV=1 59 636 6.0E-62
sp|Q73P28|SYR_TREDE Arginine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=argS PE=3 SV=1 62 636 8.0E-62
sp|B9LGY2|SYR_CHLSY Arginine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=argS PE=3 SV=1 95 636 9.0E-62
sp|A9WEH7|SYR_CHLAA Arginine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=argS PE=3 SV=1 95 636 9.0E-62
sp|Q5N643|SYR_SYNP6 Arginine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argS PE=3 SV=1 59 636 1.0E-61
sp|Q9JTM7|SYR_NEIMA Arginine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argS PE=3 SV=1 57 636 1.0E-61
sp|A5UJ40|SYR_HAEIG Arginine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=argS PE=3 SV=1 83 636 2.0E-61
sp|Q21I40|SYR_SACD2 Arginine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=argS PE=3 SV=1 79 636 2.0E-61
sp|Q48PI2|SYR_PSE14 Arginine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=argS PE=3 SV=1 82 636 3.0E-61
sp|A6VDH2|SYR_PSEA7 Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=argS PE=3 SV=1 82 608 4.0E-61
sp|B7V3E4|SYR_PSEA8 Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=argS PE=3 SV=1 82 608 5.0E-61
sp|A6W2V1|SYR_MARMS Arginine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=argS PE=3 SV=1 79 636 5.0E-61
sp|Q9HUC8|SYR_PSEAE Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argS PE=3 SV=1 82 608 8.0E-61
sp|Q02EW6|SYR_PSEAB Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argS PE=3 SV=1 82 608 1.0E-60
sp|Q9JYM8|SYR_NEIMB Arginine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argS PE=3 SV=1 57 636 1.0E-60
sp|A4VH02|SYR_PSEU5 Arginine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=argS PE=3 SV=1 49 608 4.0E-60
sp|B4RU34|SYR_ALTMD Arginine--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=argS PE=3 SV=1 147 636 9.0E-60
sp|Q6A5X8|SYR_PROAC Arginine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=argS PE=3 SV=1 80 636 9.0E-60
sp|A1KUU4|SYR_NEIMF Arginine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argS PE=3 SV=1 57 636 1.0E-59
sp|Q5F835|SYR_NEIG1 Arginine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argS PE=3 SV=1 57 636 2.0E-59
sp|B4RL22|SYR_NEIG2 Arginine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=argS PE=3 SV=1 57 636 2.0E-59
sp|C5BNG6|SYR_TERTT Arginine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=argS PE=3 SV=1 82 636 2.0E-59
sp|B4ETN5|SYR_PROMH Arginine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=argS PE=3 SV=1 83 636 4.0E-59
sp|P57851|SYR_PASMU Arginine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=argS PE=3 SV=1 75 636 1.0E-58
sp|B5RPU2|SYR_BORRA Arginine--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=argS PE=3 SV=1 62 636 1.0E-58
sp|B2J6I0|SYR_NOSP7 Arginine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argS PE=3 SV=1 33 636 2.0E-58
sp|B2S0U2|SYR_BORHD Arginine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=argS PE=3 SV=1 62 636 2.0E-58
sp|B5RME6|SYR_BORDL Arginine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=argS PE=3 SV=1 102 636 2.0E-58
sp|B7VI24|SYR_VIBTL Arginine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=argS PE=3 SV=1 155 636 3.0E-58
sp|A9MNC4|SYR_SALAR Arginine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=argS PE=3 SV=1 83 636 3.0E-58
sp|A7MT26|SYR_VIBCB Arginine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=argS PE=3 SV=1 76 636 6.0E-58
sp|Q7N565|SYR_PHOLL Arginine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argS PE=3 SV=1 134 636 6.0E-58
sp|Q0T3Q1|SYR_SHIF8 Arginine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=argS PE=3 SV=1 83 636 7.0E-58
sp|Q5QV46|SYR_IDILO Arginine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=argS PE=3 SV=1 70 636 1.0E-57
sp|Q8YQU9|SYR_NOSS1 Arginine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argS PE=3 SV=1 33 636 1.0E-57
sp|B5F3I0|SYR_SALA4 Arginine--tRNA ligase OS=Salmonella agona (strain SL483) GN=argS PE=3 SV=1 83 636 2.0E-57
sp|Q7MMM3|SYR_VIBVY Arginine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=argS PE=3 SV=1 83 636 2.0E-57
sp|Q87RD6|SYR_VIBPA Arginine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argS PE=3 SV=1 76 636 2.0E-57
sp|Q8DFR1|SYR_VIBVU Arginine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=argS PE=3 SV=1 83 636 2.0E-57
sp|A7ZN02|SYR_ECO24 Arginine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argS PE=3 SV=1 83 636 2.0E-57
sp|A8GFK2|SYR_SERP5 Arginine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=argS PE=3 SV=1 146 636 2.0E-57
sp|B4T808|SYR_SALHS Arginine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=argS PE=3 SV=1 83 636 3.0E-57
sp|Q57N89|SYR_SALCH Arginine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=argS PE=3 SV=1 83 636 3.0E-57
sp|B5FC42|SYR_VIBFM Arginine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=argS PE=3 SV=1 76 636 3.0E-57
sp|Q6LTA1|SYR_PHOPR Arginine--tRNA ligase OS=Photobacterium profundum GN=argS PE=3 SV=1 148 636 3.0E-57
sp|Q9KQC6|SYR_VIBCH Arginine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argS PE=3 SV=3 153 636 3.0E-57
sp|Q5E6L2|SYR_VIBF1 Arginine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argS PE=3 SV=1 76 636 3.0E-57
sp|B5R8C8|SYR_SALG2 Arginine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=argS PE=3 SV=1 83 636 4.0E-57
sp|Q65SX3|SYR_MANSM Arginine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argS PE=3 SV=1 83 636 4.0E-57
sp|B5FSM1|SYR_SALDC Arginine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=argS PE=3 SV=1 83 636 4.0E-57
sp|Q2J9H6|SYR_FRASC Arginine--tRNA ligase OS=Frankia sp. (strain CcI3) GN=argS PE=3 SV=2 146 636 5.0E-57
sp|Q3Z2Q4|SYR_SHISS Arginine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=argS PE=3 SV=1 83 636 5.0E-57
sp|A9MUA9|SYR_SALPB Arginine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=argS PE=3 SV=1 83 636 5.0E-57
sp|B5R142|SYR_SALEP Arginine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=argS PE=3 SV=1 83 636 6.0E-57
sp|Q7VE03|SYR_PROMA Arginine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argS PE=3 SV=1 149 636 6.0E-57
sp|B3PKE3|SYR_CELJU Arginine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=argS PE=3 SV=1 57 636 7.0E-57
sp|P0CL51|SYR_SALTY Arginine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argS PE=3 SV=1 83 636 7.0E-57
sp|E1WGF0|SYR_SALTS Arginine--tRNA ligase OS=Salmonella typhimurium (strain SL1344) GN=argS PE=3 SV=1 83 636 7.0E-57
sp|B4TYT3|SYR_SALSV Arginine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=argS PE=3 SV=1 83 636 7.0E-57
sp|Q3M769|SYR_ANAVT Arginine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argS PE=3 SV=1 33 636 7.0E-57
sp|B0KN43|SYR_PSEPG Arginine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=argS PE=3 SV=1 40 613 8.0E-57
sp|B7L7S9|SYR_ECO55 Arginine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=argS PE=3 SV=1 83 636 9.0E-57
sp|Q9C713|SYRC_ARATH Arginine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At1g66530 PE=1 SV=1 79 636 1.0E-56
sp|B4SVG0|SYR_SALNS Arginine--tRNA ligase OS=Salmonella newport (strain SL254) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|B6I0S7|SYR_ECOSE Arginine--tRNA ligase OS=Escherichia coli (strain SE11) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|B1J0L2|SYR_ECOLC Arginine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|Q8FGQ0|SYR_ECOL6 Arginine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|B5BH46|SYR_SALPK Arginine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|Q5PMZ2|SYR_SALPA Arginine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|B2U4X7|SYR_SHIB3 Arginine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|B7M2G7|SYR_ECO8A Arginine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|Q322J5|SYR_SHIBS Arginine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|B7MW70|SYR_ECO81 Arginine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|B0JLI8|SYR_MICAN Arginine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=argS PE=3 SV=1 76 636 2.0E-56
sp|B5XPZ2|SYR_KLEP3 Arginine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|B7USQ3|SYR_ECO27 Arginine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|A8A178|SYR_ECOHS Arginine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|Q4KJK0|SYR_PSEF5 Arginine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=argS PE=3 SV=1 49 636 2.0E-56
sp|P11875|SYR_ECOLI Arginine--tRNA ligase OS=Escherichia coli (strain K12) GN=argS PE=1 SV=1 83 636 2.0E-56
sp|B1XHE4|SYR_ECODH Arginine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|C4ZQG0|SYR_ECOBW Arginine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|B5YR22|SYR_ECO5E Arginine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|Q8XCH2|SYR_ECO57 Arginine--tRNA ligase OS=Escherichia coli O157:H7 GN=argS PE=3 SV=1 83 636 2.0E-56
sp|Q0TGV6|SYR_ECOL5 Arginine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argS PE=3 SV=1 83 636 2.0E-56
sp|Q8Z5V7|SYR_SALTI Arginine--tRNA ligase OS=Salmonella typhi GN=argS PE=3 SV=1 83 636 3.0E-56
sp|Q83KQ3|SYR_SHIFL Arginine--tRNA ligase OS=Shigella flexneri GN=argS PE=3 SV=1 83 636 3.0E-56
sp|B1LCZ5|SYR_ECOSM Arginine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=argS PE=3 SV=1 83 636 3.0E-56
sp|B7NBM7|SYR_ECOLU Arginine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argS PE=3 SV=1 83 636 3.0E-56
sp|B7NS42|SYR_ECO7I Arginine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=argS PE=3 SV=1 83 636 3.0E-56
sp|Q1RAQ8|SYR_ECOUT Arginine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=argS PE=3 SV=1 83 636 4.0E-56
sp|A1AC37|SYR_ECOK1 Arginine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=argS PE=3 SV=1 83 636 4.0E-56
sp|B7MBT5|SYR_ECO45 Arginine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argS PE=3 SV=1 83 636 4.0E-56
sp|B1X0N5|SYR_CYAA5 Arginine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=argS PE=3 SV=1 57 636 4.0E-56
sp|Q0I6R7|SYR_SYNS3 Arginine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=argS PE=3 SV=1 155 636 5.0E-56
sp|A8AFG5|SYR_CITK8 Arginine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=argS PE=3 SV=1 83 636 5.0E-56
sp|A6TB43|SYR_KLEP7 Arginine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=argS PE=1 SV=1 83 636 5.0E-56
sp|Q32H69|SYR_SHIDS Arginine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argS PE=3 SV=1 83 636 6.0E-56
sp|Q1IGB8|SYR_PSEE4 Arginine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=argS PE=3 SV=1 82 613 8.0E-56
sp|B6EI57|SYR_ALISL Arginine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=argS PE=3 SV=1 76 636 1.0E-55
sp|B1XPX8|SYR_SYNP2 Arginine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=argS PE=3 SV=1 79 636 1.0E-55
sp|Q3KJB3|SYR_PSEPF Arginine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=argS PE=3 SV=1 82 613 1.0E-55
sp|Q0I3B0|SYR_HAES1 Arginine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=argS PE=3 SV=1 155 636 1.0E-55
sp|B8CI29|SYR_SHEPW Arginine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=argS PE=3 SV=1 68 636 2.0E-55
sp|B0UUF1|SYR_HISS2 Arginine--tRNA ligase OS=Histophilus somni (strain 2336) GN=argS PE=3 SV=1 155 636 2.0E-55
sp|B1J2I3|SYR_PSEPW Arginine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=argS PE=3 SV=1 82 613 2.0E-55
sp|A8H953|SYR_SHEPA Arginine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=argS PE=3 SV=1 71 636 3.0E-55
sp|B0TVV1|SYR_SHEHH Arginine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=argS PE=3 SV=1 71 636 3.0E-55
sp|C4K487|SYR_HAMD5 Arginine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=argS PE=3 SV=1 83 636 4.0E-55
sp|A7MEC0|SYR_CROS8 Arginine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=argS PE=3 SV=1 83 636 7.0E-55
sp|B2VJB6|SYR_ERWT9 Arginine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argS PE=3 SV=1 153 636 9.0E-55
sp|B1KK48|SYR_SHEWM Arginine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=argS PE=3 SV=1 79 636 9.0E-55
sp|A5WAC2|SYR_PSEP1 Arginine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=argS PE=3 SV=1 82 613 1.0E-54
sp|Q0BYP8|SYR_HYPNA Arginine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=argS PE=3 SV=1 156 636 1.0E-54
sp|Q88CU1|SYR_PSEPK Arginine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=argS PE=3 SV=1 82 613 1.0E-54
sp|A2CDB7|SYR_PROM3 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=argS PE=3 SV=1 155 636 2.0E-54
sp|A9KYS9|SYR_SHEB9 Arginine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=argS PE=3 SV=1 68 636 2.0E-54
sp|A6WIK3|SYR_SHEB8 Arginine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=argS PE=3 SV=1 68 636 2.0E-54
sp|B8E6G9|SYR_SHEB2 Arginine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=argS PE=3 SV=1 68 636 2.0E-54
sp|Q7V493|SYR_PROMM Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=argS PE=3 SV=1 155 636 2.0E-54
sp|Q6D474|SYR_PECAS Arginine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argS PE=3 SV=1 83 636 2.0E-54
sp|C5B832|SYR_EDWI9 Arginine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=argS PE=3 SV=1 155 636 3.0E-54
sp|A4Y2U9|SYR_SHEPC Arginine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=argS PE=3 SV=1 68 636 3.0E-54
sp|C6DFD9|SYR_PECCP Arginine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argS PE=3 SV=1 83 636 3.0E-54
sp|Q3AVY5|SYR_SYNS9 Arginine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=argS PE=3 SV=1 159 636 3.0E-54
sp|A6VNB3|SYR_ACTSZ Arginine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=argS PE=3 SV=1 83 636 4.0E-54
sp|A1R025|SYR_BORT9 Arginine--tRNA ligase OS=Borrelia turicatae (strain 91E135) GN=argS PE=3 SV=1 62 636 4.0E-54
sp|A1RP36|SYR_SHESW Arginine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=argS PE=3 SV=1 68 636 5.0E-54
sp|A3D9A3|SYR_SHEB5 Arginine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=argS PE=3 SV=1 68 636 5.0E-54
sp|A9BDF0|SYR_PROM4 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=argS PE=3 SV=1 84 636 9.0E-54
sp|Q1CJH7|SYR_YERPN Arginine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argS PE=3 SV=1 153 636 1.0E-53
sp|Q2NTK2|SYR_SODGM Arginine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=argS PE=3 SV=1 149 636 1.0E-53
sp|A1S2P7|SYR_SHEAM Arginine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=argS PE=3 SV=1 68 636 1.0E-53
sp|C1DHR7|SYR_AZOVD Arginine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=argS PE=3 SV=1 34 613 1.0E-53
sp|A5GW85|SYR_SYNR3 Arginine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=argS PE=3 SV=1 67 636 1.0E-53
sp|A2C016|SYR_PROM1 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=argS PE=3 SV=1 144 636 1.0E-53
sp|B1JLM2|SYR_YERPY Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=argS PE=3 SV=1 153 636 1.0E-53
sp|A7FID8|SYR_YERP3 Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argS PE=3 SV=1 153 636 1.0E-53
sp|A4TJL3|SYR_YERPP Arginine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=argS PE=3 SV=1 153 636 2.0E-53
sp|A9QYY6|SYR_YERPG Arginine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=argS PE=3 SV=1 153 636 2.0E-53
sp|Q8ZEV7|SYR_YERPE Arginine--tRNA ligase OS=Yersinia pestis GN=argS PE=3 SV=1 153 636 2.0E-53
sp|Q1C827|SYR_YERPA Arginine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=argS PE=3 SV=1 153 636 2.0E-53
sp|B7JVP5|SYR_CYAP8 Arginine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=argS PE=3 SV=1 76 636 2.0E-53
sp|A4WBN1|SYR_ENT38 Arginine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=argS PE=3 SV=1 155 636 2.0E-53
sp|Q66AV1|SYR_YERPS Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argS PE=3 SV=1 153 636 2.0E-53
sp|B2K312|SYR_YERPB Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=argS PE=3 SV=1 153 636 3.0E-53
sp|Q31CZ4|SYR_PROM9 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=argS PE=3 SV=1 154 636 3.0E-53
sp|A3Q9V2|SYR_SHELP Arginine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=argS PE=3 SV=1 37 636 6.0E-53
sp|C3KAH3|SYR_PSEFS Arginine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=argS PE=3 SV=1 82 608 7.0E-53
sp|O23247|SYRM_ARATH Arginine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=EMB1027 PE=1 SV=1 79 636 8.0E-53
sp|A1JRM9|SYR_YERE8 Arginine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=argS PE=3 SV=1 153 636 1.0E-52
sp|A8FQM2|SYR_SHESH Arginine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=argS PE=3 SV=1 79 636 1.0E-52
sp|B1VTB7|SYR_STRGG Arginine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=argS PE=3 SV=1 76 636 2.0E-52
sp|Q2SMY0|SYR_HAHCH Arginine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=argS PE=3 SV=1 79 636 2.0E-52
sp|Q0HEF5|SYR_SHESM Arginine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=argS PE=3 SV=1 68 636 2.0E-52
sp|Q0HZJ6|SYR_SHESR Arginine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=argS PE=3 SV=1 68 636 2.0E-52
sp|A0L1H3|SYR_SHESA Arginine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=argS PE=3 SV=1 68 636 4.0E-52
sp|Q10XL4|SYR_TRIEI Arginine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=argS PE=3 SV=1 37 636 6.0E-52
sp|Q1LTI8|SYR_BAUCH Arginine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=argS PE=3 SV=1 153 636 7.0E-52
sp|Q46HI6|SYR_PROMT Arginine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=argS PE=3 SV=1 144 636 8.0E-52
sp|Q7V396|SYR_PROMP Arginine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argS PE=3 SV=1 80 636 9.0E-52
sp|B8HSK8|SYR_CYAP4 Arginine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=argS PE=3 SV=1 85 636 1.0E-51
sp|Q8E9Y7|SYR_SHEON Arginine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=argS PE=3 SV=1 68 636 1.0E-51
sp|B2S469|SYR_TREPS Arginine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=argS PE=3 SV=1 33 636 2.0E-51
sp|O83803|SYR_TREPA Arginine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=argS PE=3 SV=1 33 636 2.0E-51
sp|A5GP97|SYR_SYNPW Arginine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=argS PE=3 SV=1 155 636 2.0E-51
sp|Q12IU3|SYR_SHEDO Arginine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=argS PE=3 SV=1 68 636 3.0E-51
sp|B7LPH0|SYR_ESCF3 Arginine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=argS PE=3 SV=1 152 636 4.0E-51
sp|Q487B1|SYR_COLP3 Arginine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=argS PE=3 SV=1 148 636 7.0E-51
sp|Q6P1S4|SYRC_XENTR Arginine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=rars PE=2 SV=1 70 636 1.0E-50
sp|Q3IHI4|SYR_PSEHT Arginine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=argS PE=3 SV=1 76 636 1.0E-50
sp|Q4J904|SYR_SULAC Arginine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=argS PE=3 SV=1 30 636 1.0E-50
sp|Q7VP38|SYR_HAEDU Arginine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argS PE=3 SV=1 83 636 1.0E-50
sp|O51540|SYR_BORBU Arginine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=argS PE=3 SV=2 106 636 1.0E-50
sp|O29368|SYR_ARCFU Arginine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argS PE=3 SV=1 80 636 2.0E-50
sp|Q47TB0|SYR_THEFY Arginine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=argS PE=3 SV=1 148 636 3.0E-50
sp|Q492L0|SYR_BLOPB Arginine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=argS PE=3 SV=1 153 636 3.0E-50
sp|B7KCT7|SYR_CYAP7 Arginine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=argS PE=3 SV=1 58 636 3.0E-50
sp|Q07WM5|SYR_SHEFN Arginine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=argS PE=3 SV=1 68 636 6.0E-50
sp|Q08888|SYR_BUCAP Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argS PE=3 SV=2 152 636 6.0E-50
sp|A5FND6|SYR_FLAJ1 Arginine--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=argS PE=3 SV=1 67 636 1.0E-49
sp|Q7U3V8|SYR_SYNPX Arginine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=argS PE=3 SV=1 155 613 4.0E-49
sp|Q8DKN4|SYR_THEEB Arginine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=argS PE=3 SV=1 146 636 8.0E-49
sp|A7YW98|SYRC_BOVIN Arginine--tRNA ligase, cytoplasmic OS=Bos taurus GN=RARS PE=2 SV=1 39 636 1.0E-48
sp|Q82E68|SYR_STRAW Arginine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argS PE=3 SV=1 76 636 1.0E-48
sp|A4XPN9|SYR_PSEMY Arginine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=argS PE=3 SV=1 55 608 2.0E-48
sp|C4ZD15|SYR_EUBR3 Arginine--tRNA ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=argS PE=3 SV=1 143 636 3.0E-48
sp|Q660S8|SYR_BORBP Arginine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=argS PE=3 SV=1 107 636 4.0E-48
sp|Q3AGU9|SYR_SYNSC Arginine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=argS PE=3 SV=1 155 613 4.0E-48
sp|Q97ZN1|SYR_SULSO Arginine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argS PE=3 SV=1 49 636 5.0E-48
sp|Q0W6L7|SYR_METAR Arginine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=argS PE=3 SV=1 68 636 5.0E-48
sp|Q5UQ59|SYR_MIMIV Arginine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus GN=RARS PE=3 SV=1 114 636 1.0E-47
sp|Q5RA20|SYRC_PONAB Arginine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=RARS PE=2 SV=1 80 636 1.0E-47
sp|Q5ZM11|SYRC_CHICK Arginine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=RARS PE=2 SV=1 39 636 2.0E-47
sp|Q5L6U4|SYR_CHLAB Arginine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=argS PE=3 SV=1 141 636 2.0E-47
sp|Q9Z7Y3|SYR_CHLPN Arginine--tRNA ligase OS=Chlamydia pneumoniae GN=argS PE=3 SV=1 79 636 4.0E-47
sp|P37880|SYRC_CRIGR Arginine--tRNA ligase, cytoplasmic OS=Cricetulus griseus GN=RARS PE=2 SV=1 148 636 6.0E-47
sp|P54136|SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=RARS PE=1 SV=2 80 636 9.0E-47
sp|Q3KLP4|SYR_CHLTA Arginine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=argS PE=3 SV=1 79 636 1.0E-46
sp|Q6MEP4|SYR_PARUW Arginine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=argS PE=3 SV=1 118 636 1.0E-46
sp|P59483|SYR_BUCBP Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=argS PE=3 SV=1 153 636 1.0E-46
sp|A0Q5D7|SYR_FRATN Arginine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=argS PE=3 SV=1 122 636 2.0E-46
sp|Q9WX29|SYR_STRCO Arginine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argS PE=3 SV=1 76 636 2.0E-46
sp|Q9D0I9|SYRC_MOUSE Arginine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Rars PE=1 SV=2 39 636 3.0E-46
sp|B2SDQ4|SYR_FRATM Arginine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=argS PE=3 SV=1 122 636 5.0E-46
sp|A6LHY5|SYR_PARD8 Arginine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=argS PE=3 SV=1 155 636 5.0E-46
sp|A4IZF4|SYR_FRATW Arginine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=argS PE=3 SV=1 122 636 6.0E-46
sp|Q0BKP4|SYR_FRATO Arginine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=argS PE=3 SV=1 122 636 7.0E-46
sp|Q2A215|SYR_FRATH Arginine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=argS PE=3 SV=1 122 636 7.0E-46
sp|A7NDV6|SYR_FRATF Arginine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=argS PE=3 SV=1 122 636 7.0E-46
sp|Q0AMI8|SYR_MARMM Arginine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=argS PE=3 SV=1 153 616 7.0E-46
sp|O84460|SYR_CHLTR Arginine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=argS PE=3 SV=1 83 636 1.0E-45
sp|Q0SMR4|SYR_BORAP Arginine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=argS PE=3 SV=1 107 636 2.0E-45
sp|Q5NHI8|SYR_FRATT Arginine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=argS PE=3 SV=1 122 636 2.0E-45
sp|Q14IZ0|SYR_FRAT1 Arginine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=argS PE=3 SV=1 122 636 2.0E-45
sp|P40329|SYRC_RAT Arginine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Rars PE=1 SV=2 153 636 3.0E-45
sp|B4R8T9|SYR_PHEZH Arginine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=argS PE=3 SV=1 153 636 3.0E-45
sp|Q9PJT8|SYR_CHLMU Arginine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=argS PE=3 SV=1 76 636 7.0E-45
sp|Q8D372|SYR_WIGBR Arginine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=argS PE=3 SV=1 152 636 9.0E-45
sp|Q44683|SYR_BUCAI Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argS PE=3 SV=2 153 636 1.0E-44
sp|B8D940|SYR_BUCA5 Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=argS PE=3 SV=1 153 636 1.0E-44
sp|Q7VQX7|SYR_BLOFL Arginine--tRNA ligase OS=Blochmannia floridanus GN=argS PE=3 SV=1 109 636 1.0E-44
sp|B8D7E4|SYR_BUCAT Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=argS PE=3 SV=1 153 636 1.0E-44
sp|Q824H4|SYR_CHLCV Arginine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=argS PE=3 SV=1 76 636 2.0E-44
sp|Q12V97|SYR_METBU Arginine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=argS PE=3 SV=1 95 636 2.0E-44
sp|B0T019|SYR_CAUSK Arginine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=argS PE=3 SV=1 143 636 2.0E-44
sp|Q971X1|SYR_SULTO Arginine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argS PE=3 SV=1 30 636 4.0E-44
sp|Q253D1|SYR_CHLFF Arginine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=argS PE=3 SV=1 150 636 5.0E-44
sp|Q9A347|SYR_CAUCR Arginine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argS PE=3 SV=1 153 636 1.0E-43
sp|B8H4W0|SYR_CAUCN Arginine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=argS PE=3 SV=1 153 636 1.0E-43
sp|Q8PX74|SYR_METMA Arginine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argS PE=3 SV=1 95 636 1.0E-43
sp|Q19825|SYRC_CAEEL Probable arginine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=rrt-1 PE=3 SV=2 74 636 4.0E-43
sp|B2RHN9|SYR_PORG3 Arginine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=argS PE=3 SV=1 155 636 5.0E-43
sp|Q5UXX8|SYR_HALMA Arginine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=argS PE=3 SV=1 155 630 6.0E-43
sp|A6GZP8|SYR_FLAPJ Arginine--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=argS PE=3 SV=1 146 636 8.0E-43
sp|A8AB06|SYR_IGNH4 Arginine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=argS PE=3 SV=1 154 636 1.0E-42
sp|Q9VXN4|SYRC_DROME Probable arginine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster GN=Aats-arg PE=2 SV=1 79 636 2.0E-42
sp|Q7MXD5|SYR_PORGI Arginine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=argS PE=3 SV=1 155 636 4.0E-42
sp|B3ERZ8|SYR_AMOA5 Arginine--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=argS PE=3 SV=1 148 636 6.0E-42
sp|A8MKD9|SYR_ALKOO Arginine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=argS PE=3 SV=1 73 636 9.0E-42
sp|Q8A3X5|SYR_BACTN Arginine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=argS PE=3 SV=1 155 636 9.0E-42
sp|Q46DR6|SYR_METBF Arginine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=argS PE=3 SV=1 37 636 1.0E-41
sp|Q8TUM3|SYR_METAC Arginine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argS PE=3 SV=1 80 636 2.0E-41
sp|Q5L7Q8|SYR_BACFN Arginine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=argS PE=3 SV=1 155 636 4.0E-40
sp|Q6MLI2|SYR_BDEBA Arginine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=argS PE=3 SV=1 154 636 4.0E-40
sp|Q64MX8|SYR_BACFR Arginine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=argS PE=3 SV=1 155 636 4.0E-40
sp|A7I4Y2|SYR_METB6 Arginine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=argS PE=3 SV=1 107 636 6.0E-40
sp|A6KZA8|SYR_BACV8 Arginine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=argS PE=3 SV=1 155 636 1.0E-38
sp|B8GJL7|SYR_METPE Arginine--tRNA ligase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=argS PE=3 SV=1 107 636 4.0E-38
sp|Q5JGH7|SYR_THEKO Arginine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argS PE=3 SV=1 153 636 6.0E-38
sp|A0B5P0|SYR_METTP Arginine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=argS PE=3 SV=1 155 636 2.0E-37
sp|Q9V0V2|SYR_PYRAB Arginine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argS PE=3 SV=1 109 636 7.0E-37
sp|A1RS32|SYR_PYRIL Arginine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=argS PE=3 SV=1 155 636 5.0E-36
sp|Q5X3M1|SYR_LEGPA Arginine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=argS PE=3 SV=1 70 636 2.0E-35
sp|A5IDL4|SYR_LEGPC Arginine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=argS PE=3 SV=1 70 636 2.0E-35
sp|Q5ZTX7|SYR_LEGPH Arginine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=argS PE=3 SV=1 70 636 3.0E-35
sp|A2STL6|SYR_METLZ Arginine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=argS PE=3 SV=1 91 636 3.0E-35
sp|Q18FC1|SYR_HALWD Arginine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=argS PE=3 SV=1 148 636 5.0E-35
sp|Q3IUQ6|SYR_NATPD Arginine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=argS PE=3 SV=1 105 603 7.0E-35
sp|Q5WV09|SYR_LEGPL Arginine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=argS PE=3 SV=1 70 636 2.0E-34
sp|Q8U149|SYR_PYRFU Arginine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argS PE=3 SV=1 100 636 2.0E-34
sp|Q057S1|SYR_BUCCC Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=argS PE=3 SV=1 153 636 4.0E-34
sp|Q8TXB6|SYR_METKA Arginine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argS PE=3 SV=1 37 636 7.0E-34
sp|O27496|SYR_METTH Arginine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argS PE=3 SV=1 62 636 6.0E-33
sp|Q2NE12|SYR_METST Arginine--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=argS PE=3 SV=1 62 636 5.0E-32
sp|C6BU27|SYR_DESAD Arginine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=argS PE=3 SV=1 51 636 7.0E-32
sp|Q2FS66|SYR_METHJ Arginine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=argS PE=3 SV=1 106 636 1.0E-31
sp|Q8ZTA8|SYR_PYRAE Arginine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argS PE=3 SV=1 156 636 2.0E-31
sp|B8DNX4|SYR_DESVM Arginine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=argS PE=3 SV=1 151 636 2.0E-31
sp|B1L3E4|SYR_KORCO Arginine--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=argS PE=3 SV=1 156 636 2.0E-31
sp|Q9YB39|SYR_AERPE Arginine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=argS PE=3 SV=1 30 636 9.0E-31
sp|Q9K6C1|SYR1_BACHD Arginine--tRNA ligase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argS1 PE=3 SV=1 49 636 1.0E-30
sp|A5UMK8|SYR_METS3 Arginine--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=argS PE=3 SV=1 59 636 1.0E-30
sp|Q4L425|SYR_STAHJ Arginine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argS PE=3 SV=1 63 636 2.0E-30
sp|A1TYU8|SYR_MARHV Arginine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=argS PE=3 SV=1 70 636 4.0E-30
sp|O59147|SYR_PYRHO Arginine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argS PE=1 SV=1 153 636 6.0E-30
sp|Q8Y493|SYR_LISMO Arginine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argS PE=3 SV=1 39 636 9.0E-30
sp|C5ZZZ3|SYR_THESM Arginine--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=argS PE=3 SV=1 85 636 1.0E-29
sp|Q6LYG5|SYR_METMP Arginine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=argS PE=3 SV=1 100 630 1.0E-29
sp|B8DBE8|SYR_LISMH Arginine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=argS PE=3 SV=1 38 636 2.0E-29
sp|Q1QZZ4|SYR_CHRSD Arginine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=argS PE=3 SV=1 70 636 3.0E-29
sp|Q927T2|SYR_LISIN Arginine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argS PE=3 SV=1 39 636 3.0E-29
sp|A4FXF3|SYR_METM5 Arginine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=argS PE=3 SV=1 100 630 3.0E-29
sp|B8GU79|SYR_THISH Arginine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=argS PE=3 SV=1 70 636 4.0E-29
sp|B3QLU7|SYR_CHLP8 Arginine--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=argS PE=3 SV=1 68 636 4.0E-29
sp|C0QKZ8|SYR_DESAH Arginine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=argS PE=3 SV=1 74 636 6.0E-29
sp|A6VFW2|SYR_METM7 Arginine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=argS PE=3 SV=1 100 630 7.0E-29
sp|Q7W0K0|SYR_BORPE Arginine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argS PE=3 SV=2 70 636 7.0E-29
sp|Q7WDQ0|SYR_BORBR Arginine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argS PE=3 SV=1 70 636 9.0E-29
sp|B9LRF1|SYR_HALLT Arginine--tRNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=argS PE=3 SV=1 155 636 9.0E-29
sp|Q7W2Q2|SYR_BORPA Arginine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argS PE=3 SV=1 70 636 1.0E-28
sp|Q602H4|SYR_METCA Arginine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argS PE=3 SV=1 71 636 1.0E-28
sp|Q71WL8|SYR_LISMF Arginine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argS PE=3 SV=1 39 636 2.0E-28
sp|A6UW07|SYR_META3 Arginine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=argS PE=3 SV=1 109 636 2.0E-28
sp|A9AAS2|SYR_METM6 Arginine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=argS PE=3 SV=1 100 630 2.0E-28
sp|A3PK32|SYR_RHOS1 Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argS PE=3 SV=1 153 636 3.0E-28
sp|Q8R786|SYR_CALS4 Arginine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argS PE=3 SV=1 62 636 3.0E-28
sp|C1KYX7|SYR_LISMC Arginine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=argS PE=3 SV=1 39 636 4.0E-28
sp|B4SH34|SYR_PELPB Arginine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=argS PE=3 SV=1 34 636 4.0E-28
sp|Q57689|SYR_METJA Arginine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argS PE=3 SV=1 154 636 4.0E-28
sp|Q3J281|SYR_RHOS4 Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argS PE=3 SV=2 153 636 5.0E-28
sp|A4WLP0|SYR_PYRAR Arginine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=argS PE=3 SV=1 155 636 5.0E-28
sp|B9KSX6|SYR_RHOSK Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=argS PE=3 SV=1 153 636 5.0E-28
sp|A8FIG8|SYR_BACP2 Arginine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=argS PE=3 SV=1 100 636 6.0E-28
sp|A9BRF4|SYR_DELAS Arginine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=argS PE=3 SV=1 70 636 6.0E-28
sp|A0ALP7|SYR_LISW6 Arginine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=argS PE=3 SV=1 39 636 9.0E-28
sp|B8I592|SYR_CLOCE Arginine--tRNA ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=argS PE=3 SV=1 64 636 1.0E-27
sp|B0VBN5|SYR_ACIBY Arginine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=argS PE=3 SV=1 68 636 1.0E-27
sp|B2I0Y7|SYR_ACIBC Arginine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=argS PE=3 SV=1 68 636 1.0E-27
sp|B7I1U9|SYR_ACIB5 Arginine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=argS PE=3 SV=1 68 636 1.0E-27
sp|B7H2A9|SYR_ACIB3 Arginine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=argS PE=3 SV=1 68 636 1.0E-27
sp|A5G3W5|SYR_GEOUR Arginine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=argS PE=3 SV=1 55 636 2.0E-27
sp|B4S6D8|SYR_PROA2 Arginine--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=argS PE=3 SV=1 62 631 2.0E-27
sp|A6UP37|SYR_METVS Arginine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=argS PE=3 SV=1 62 630 2.0E-27
sp|A4SGY3|SYR_CHLPM Arginine--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=argS PE=3 SV=1 62 636 2.0E-27
sp|Q72CN5|SYR_DESVH Arginine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argS PE=3 SV=1 147 636 2.0E-27
sp|A3DGS4|SYR_CLOTH Arginine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=argS PE=3 SV=1 100 636 2.0E-27
sp|A1VEG5|SYR_DESVV Arginine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argS PE=3 SV=1 147 636 2.0E-27
sp|B0TI89|SYR_HELMI Arginine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=argS PE=3 SV=1 58 636 3.0E-27
sp|Q2RFU7|SYR_MOOTA Arginine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=argS PE=3 SV=1 98 636 3.0E-27
sp|B0VNJ1|SYR_ACIBS Arginine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=argS PE=3 SV=1 68 636 3.0E-27
sp|Q74C63|SYR_GEOSL Arginine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argS PE=3 SV=2 62 636 5.0E-27
sp|B9DKQ7|SYR_STACT Arginine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=argS PE=3 SV=1 62 636 8.0E-27
sp|A7Z9V1|SYR_BACMF Arginine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=argS PE=3 SV=1 34 636 1.0E-26
sp|Q1MRU1|SYR_LAWIP Arginine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=argS PE=3 SV=1 48 636 1.0E-26
sp|Q31J79|SYR_THICR Arginine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=argS PE=3 SV=1 71 636 1.0E-26
sp|P46906|SYR_BACSU Arginine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=argS PE=3 SV=2 100 636 2.0E-26
sp|B1XYP5|SYR_LEPCP Arginine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=argS PE=3 SV=1 55 636 2.0E-26
sp|Q6NHU6|SYR_CORDI Arginine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argS PE=3 SV=1 62 636 2.0E-26
sp|Q3SF80|SYR_THIDA Arginine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argS PE=3 SV=1 79 636 3.0E-26
sp|Q3AFT8|SYR_CARHZ Arginine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argS PE=3 SV=1 62 636 3.0E-26
sp|Q3ANY2|SYR_CHLCH Arginine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=argS PE=3 SV=1 59 636 3.0E-26
sp|A9KH27|SYR_COXBN Arginine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=argS PE=3 SV=2 66 636 3.0E-26
sp|Q0SGN1|SYR_RHOJR Arginine--tRNA ligase OS=Rhodococcus jostii (strain RHA1) GN=argS PE=3 SV=1 46 636 4.0E-26
sp|B3EIJ1|SYR_CHLL2 Arginine--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=argS PE=3 SV=1 62 636 5.0E-26
sp|Q9HLE7|SYR_THEAC Arginine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=argS PE=3 SV=1 153 636 5.0E-26
sp|Q164C1|SYR_ROSDO Arginine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=argS PE=3 SV=1 106 636 6.0E-26
sp|B6J667|SYR_COXB1 Arginine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=argS PE=3 SV=1 66 636 6.0E-26
sp|A9N9G2|SYR_COXBR Arginine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=argS PE=3 SV=1 66 636 6.0E-26
sp|Q83A98|SYR_COXBU Arginine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=argS PE=3 SV=1 66 636 7.0E-26
sp|Q123B6|SYR_POLSJ Arginine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=argS PE=3 SV=1 154 636 9.0E-26
sp|A1TJ83|SYR_ACIAC Arginine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=argS PE=3 SV=1 70 636 9.0E-26
sp|C1A1Z7|SYR_RHOE4 Arginine--tRNA ligase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=argS PE=3 SV=1 33 636 1.0E-25
sp|B9MBD2|SYR_ACIET Arginine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=argS PE=3 SV=1 62 636 1.0E-25
sp|Q220N0|SYR_RHOFT Arginine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=argS PE=3 SV=1 91 636 1.0E-25
sp|A1AVC2|SYR_RUTMC Arginine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argS PE=3 SV=1 83 636 1.0E-25
sp|B6J3D4|SYR_COXB2 Arginine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=argS PE=3 SV=1 66 636 1.0E-25
sp|A0L5I2|SYR_MAGMM Arginine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=argS PE=3 SV=1 71 630 1.0E-25
sp|A5CXW2|SYR_VESOH Arginine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=argS PE=3 SV=1 67 636 2.0E-25
sp|Q49VF3|SYR_STAS1 Arginine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argS PE=3 SV=1 79 636 2.0E-25
sp|C1AW17|SYR_RHOOB Arginine--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=argS PE=3 SV=1 62 636 2.0E-25
sp|Q8CTN9|SYR_STAES Arginine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argS PE=3 SV=1 62 636 2.0E-25
sp|Q39VQ6|SYR_GEOMG Arginine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argS PE=3 SV=2 137 636 2.0E-25
sp|C3PFN8|SYR_CORA7 Arginine--tRNA ligase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=argS PE=3 SV=1 62 636 2.0E-25
sp|Q65DS9|SYR_BACLD Arginine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=argS PE=3 SV=1 106 636 2.0E-25
sp|Q5HRD1|SYR_STAEQ Arginine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argS PE=3 SV=1 79 636 3.0E-25
sp|B1L826|SYR_THESQ Arginine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=argS PE=3 SV=1 62 636 4.0E-25
sp|B5EL87|SYR_ACIF5 Arginine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=argS PE=3 SV=1 62 636 5.0E-25
sp|B7J3R6|SYR_ACIF2 Arginine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=argS PE=3 SV=1 62 636 5.0E-25
sp|Q6GJ61|SYR_STAAR Arginine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=argS PE=3 SV=1 62 636 6.0E-25
sp|Q30Z04|SYR_DESAG Arginine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=argS PE=3 SV=1 51 636 6.0E-25
sp|A6SU56|SYR_JANMA Arginine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=argS PE=3 SV=1 99 636 8.0E-25
sp|Q8EM45|SYR_OCEIH Arginine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argS PE=3 SV=1 62 636 8.0E-25
sp|Q5WB34|SYR_BACSK Arginine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=argS PE=3 SV=1 57 636 9.0E-25
sp|Q2YSW8|SYR_STAAB Arginine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=argS PE=3 SV=1 62 636 9.0E-25
sp|Q0AFN4|SYR_NITEC Arginine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=argS PE=3 SV=1 32 636 9.0E-25
sp|A9A099|SYR_DESOH Arginine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=argS PE=3 SV=1 151 636 1.0E-24
sp|Q6GBM1|SYR_STAAS Arginine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|Q9X0H8|SYR_THEMA Arginine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|Q8NXT8|SYR_STAAW Arginine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|A8Z117|SYR_STAAT Arginine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|A6QER9|SYR_STAAE Arginine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|Q5HI60|SYR_STAAC Arginine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|Q2G0F8|SYR_STAA8 Arginine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|Q2FJ29|SYR_STAA3 Arginine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|Q932F6|SYR_STAAM Arginine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|A7WZ56|SYR_STAA1 Arginine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|Q99W05|SYR_STAAN Arginine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=argS PE=1 SV=1 62 636 1.0E-24
sp|A5IQG1|SYR_STAA9 Arginine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|A6TZ85|SYR_STAA2 Arginine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|B3EQ83|SYR_CHLPB Arginine--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=argS PE=3 SV=1 62 636 1.0E-24
sp|B8FCL2|SYR_DESAA Arginine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=argS PE=3 SV=1 36 636 2.0E-24
sp|Q82XC1|SYR_NITEU Arginine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argS PE=3 SV=1 51 636 3.0E-24
sp|Q8KGF3|SYR_CHLTE Arginine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argS PE=3 SV=1 68 636 3.0E-24
sp|B5EEF0|SYR_GEOBB Arginine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=argS PE=3 SV=1 62 636 3.0E-24
sp|A1VTL9|SYR_POLNA Arginine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=argS PE=3 SV=1 148 636 4.0E-24
sp|Q63Y06|SYR_BURPS Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|A3N542|SYR_BURP6 Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|A3NQU2|SYR_BURP0 Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|Q3JWP7|SYR_BURP1 Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|A1V839|SYR_BURMS Arginine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|Q62MY7|SYR_BURMA Arginine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|A2S7P3|SYR_BURM9 Arginine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|A3MNI3|SYR_BURM7 Arginine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=argS PE=3 SV=1 50 636 4.0E-24
sp|A4WQZ1|SYR_RHOS5 Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=argS PE=3 SV=1 153 636 4.0E-24
sp|Q6AJJ9|SYR_DESPS Arginine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argS PE=3 SV=1 67 636 4.0E-24
sp|A5IN82|SYR_THEP1 Arginine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=argS PE=3 SV=1 62 636 6.0E-24
sp|Q3ZYF0|SYR_DEHMC Arginine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=argS PE=3 SV=1 62 636 6.0E-24
sp|Q3A6K6|SYR_PELCD Arginine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argS PE=3 SV=1 62 636 6.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006420 arginyl-tRNA aminoacylation Yes
GO:0004814 arginine-tRNA ligase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016874 ligase activity No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0009987 cellular process No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006418 tRNA aminoacylation for protein translation No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0004812 aminoacyl-tRNA ligase activity No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1185
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4349 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3274
Ophiocordyceps camponoti-floridani Ophcf2|06673
Ophiocordyceps camponoti-rufipedis Ophun1|108
Ophiocordyceps kimflemingae Ophio5|7460
Ophiocordyceps subramaniannii Hirsu2|10328

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4349
MASDASFEKLADQFKHLPLIDKYPNCFPDINPVDIYRAHITSILHDITGVDKTIIYPALLWPATLEKGDLTLAIP
ALRVKGKPDELGKQWLEKWPESPLVEKPVQTGPFFPFFFKTAPLTKTVIPMALSHRTDFGANRALGLRDQIDPSK
GRKRMIVEFSSPNIAKPFHAGHLRSTIIGGFISNLYRVAGWDVTTINYLGDWGKQYGVLALGFEKYGNETDLEQD
PINHLFHVYVKISKDVAAEKEQAEKLKTEGKEAEANKVLEKGLDEQARQYFKRMTQGDAKALALWSRFREFSIKR
YKETYARLNIHFDEYSGESKVSEDDMQNAAEKMKEIGLAEDHDGALLIDFVKNIPGKEGKQLGKAILRKKDGTAL
YLTRDISELMSRHDRYHFDQMIYVIASEQDLHVKQFFKVVSMMGHKDIADKCQHINFGLVLGMSTRKGTVKFLDD
ILRDVGDHMHETMRKNEEKYQQVENPVKTADTLGISSVMVQDMLGKRINNYTFDLQRMTSFEGDTGPYLQYAHAR
LCSITRKAGLSEEDLESADLSLLTEPMAINLVRVISQWPDVVQNTLRTLEPTTVLTYLFKMTHVLSTSYSHLRIV
GSEPEVMKARMALYDAARVVLYNGMRLLGLSPLERM*
Coding >OphauG2|4349
ATGGCTAGCGACGCATCCTTTGAAAAACTGGCTGACCAGTTCAAACACTTACCGCTTATCGACAAGTACCCAAAC
TGCTTTCCCGATATTAATCCAGTCGACATATACCGCGCGCACATTACAAGCATCCTGCACGACATTACGGGTGTC
GACAAAACCATCATCTACCCGGCTCTGTTATGGCCTGCAACACTGGAAAAGGGGGACCTCACTTTAGCCATACCA
GCTCTCCGCGTCAAGGGAAAGCCTGACGAACTGGGCAAGCAATGGCTGGAAAAGTGGCCAGAGTCGCCTCTTGTT
GAGAAGCCTGTGCAAACGGGGCCCTTCTTTCCCTTCTTCTTCAAAACCGCACCCTTGACCAAGACGGTTATTCCC
ATGGCATTGTCCCACCGAACAGACTTTGGCGCCAACCGAGCTCTGGGCCTTCGAGACCAAATCGACCCCTCCAAG
GGCAGGAAAAGAATGATTGTCGAGTTTTCAAGCCCCAACATTGCAAAACCTTTTCATGCCGGTCATTTGCGAAGC
ACAATCATTGGCGGCTTTATTTCAAACCTCTATAGAGTTGCAGGATGGGATGTAACAACCATTAACTATCTAGGA
GATTGGGGAAAGCAATACGGCGTGCTAGCCTTGGGCTTTGAAAAATATGGCAACGAGACGGATCTCGAGCAAGAT
CCCATCAACCATCTCTTTCATGTCTATGTCAAGATAAGCAAAGATGTGGCTGCTGAGAAGGAGCAGGCTGAGAAA
CTAAAAACCGAGGGCAAGGAAGCCGAAGCCAACAAGGTCTTAGAGAAGGGCCTGGACGAACAGGCCCGGCAGTAC
TTTAAGAGAATGACTCAAGGCGATGCCAAGGCATTGGCGCTTTGGAGTCGCTTCCGCGAATTCAGCATCAAGCGC
TACAAGGAAACGTATGCTCGGCTCAATATTCATTTTGACGAATACTCTGGCGAGAGCAAGGTTTCAGAAGACGAC
ATGCAAAATGCGGCTGAAAAGATGAAGGAGATTGGATTGGCCGAGGACCATGACGGCGCTCTTCTCATCGACTTT
GTCAAGAACATACCCGGCAAAGAGGGCAAGCAGTTGGGAAAAGCCATCCTGCGCAAAAAGGATGGCACAGCTCTT
TATCTGACCCGAGATATTTCCGAACTAATGAGCCGCCACGACCGGTACCACTTTGACCAAATGATATACGTTATT
GCCTCGGAGCAAGATCTTCATGTGAAGCAGTTCTTCAAAGTTGTGTCAATGATGGGCCATAAGGACATTGCCGAT
AAGTGCCAACACATCAACTTTGGTCTTGTTCTCGGAATGAGCACTCGAAAAGGGACTGTCAAGTTTCTTGACGAC
ATTCTCAGAGACGTTGGTGATCATATGCACGAGACGATGCGGAAAAATGAAGAAAAATACCAGCAAGTCGAAAAT
CCAGTCAAGACTGCCGATACCCTCGGAATATCTTCTGTCATGGTGCAGGACATGCTGGGCAAGCGGATCAACAAT
TACACATTTGACTTGCAGAGGATGACAAGTTTTGAAGGCGACACTGGCCCTTATCTCCAATATGCGCATGCGCGA
CTGTGCTCCATTACGCGCAAGGCCGGACTGTCTGAAGAGGATCTCGAATCAGCGGATCTGTCCCTGTTGACAGAG
CCCATGGCCATTAATCTGGTTCGCGTAATCAGCCAATGGCCTGATGTGGTGCAAAATACGCTTCGCACACTGGAG
CCTACTACAGTTCTTACATATCTCTTCAAGATGACTCATGTGCTCAGCACGAGCTACAGCCACCTTCGGATCGTG
GGAAGCGAGCCTGAAGTAATGAAGGCGCGAATGGCCTTGTACGATGCAGCGCGAGTCGTACTGTACAATGGCATG
CGGTTGCTTGGACTTTCGCCATTGGAGAGAATGTGA
Transcript >OphauG2|4349
ATGGCTAGCGACGCATCCTTTGAAAAACTGGCTGACCAGTTCAAACACTTACCGCTTATCGACAAGTACCCAAAC
TGCTTTCCCGATATTAATCCAGTCGACATATACCGCGCGCACATTACAAGCATCCTGCACGACATTACGGGTGTC
GACAAAACCATCATCTACCCGGCTCTGTTATGGCCTGCAACACTGGAAAAGGGGGACCTCACTTTAGCCATACCA
GCTCTCCGCGTCAAGGGAAAGCCTGACGAACTGGGCAAGCAATGGCTGGAAAAGTGGCCAGAGTCGCCTCTTGTT
GAGAAGCCTGTGCAAACGGGGCCCTTCTTTCCCTTCTTCTTCAAAACCGCACCCTTGACCAAGACGGTTATTCCC
ATGGCATTGTCCCACCGAACAGACTTTGGCGCCAACCGAGCTCTGGGCCTTCGAGACCAAATCGACCCCTCCAAG
GGCAGGAAAAGAATGATTGTCGAGTTTTCAAGCCCCAACATTGCAAAACCTTTTCATGCCGGTCATTTGCGAAGC
ACAATCATTGGCGGCTTTATTTCAAACCTCTATAGAGTTGCAGGATGGGATGTAACAACCATTAACTATCTAGGA
GATTGGGGAAAGCAATACGGCGTGCTAGCCTTGGGCTTTGAAAAATATGGCAACGAGACGGATCTCGAGCAAGAT
CCCATCAACCATCTCTTTCATGTCTATGTCAAGATAAGCAAAGATGTGGCTGCTGAGAAGGAGCAGGCTGAGAAA
CTAAAAACCGAGGGCAAGGAAGCCGAAGCCAACAAGGTCTTAGAGAAGGGCCTGGACGAACAGGCCCGGCAGTAC
TTTAAGAGAATGACTCAAGGCGATGCCAAGGCATTGGCGCTTTGGAGTCGCTTCCGCGAATTCAGCATCAAGCGC
TACAAGGAAACGTATGCTCGGCTCAATATTCATTTTGACGAATACTCTGGCGAGAGCAAGGTTTCAGAAGACGAC
ATGCAAAATGCGGCTGAAAAGATGAAGGAGATTGGATTGGCCGAGGACCATGACGGCGCTCTTCTCATCGACTTT
GTCAAGAACATACCCGGCAAAGAGGGCAAGCAGTTGGGAAAAGCCATCCTGCGCAAAAAGGATGGCACAGCTCTT
TATCTGACCCGAGATATTTCCGAACTAATGAGCCGCCACGACCGGTACCACTTTGACCAAATGATATACGTTATT
GCCTCGGAGCAAGATCTTCATGTGAAGCAGTTCTTCAAAGTTGTGTCAATGATGGGCCATAAGGACATTGCCGAT
AAGTGCCAACACATCAACTTTGGTCTTGTTCTCGGAATGAGCACTCGAAAAGGGACTGTCAAGTTTCTTGACGAC
ATTCTCAGAGACGTTGGTGATCATATGCACGAGACGATGCGGAAAAATGAAGAAAAATACCAGCAAGTCGAAAAT
CCAGTCAAGACTGCCGATACCCTCGGAATATCTTCTGTCATGGTGCAGGACATGCTGGGCAAGCGGATCAACAAT
TACACATTTGACTTGCAGAGGATGACAAGTTTTGAAGGCGACACTGGCCCTTATCTCCAATATGCGCATGCGCGA
CTGTGCTCCATTACGCGCAAGGCCGGACTGTCTGAAGAGGATCTCGAATCAGCGGATCTGTCCCTGTTGACAGAG
CCCATGGCCATTAATCTGGTTCGCGTAATCAGCCAATGGCCTGATGTGGTGCAAAATACGCTTCGCACACTGGAG
CCTACTACAGTTCTTACATATCTCTTCAAGATGACTCATGTGCTCAGCACGAGCTACAGCCACCTTCGGATCGTG
GGAAGCGAGCCTGAAGTAATGAAGGCGCGAATGGCCTTGTACGATGCAGCGCGAGTCGTACTGTACAATGGCATG
CGGTTGCTTGGACTTTCGCCATTGGAGAGAATGTGA
Gene >OphauG2|4349
ATGGCTAGCGACGCATCCTTTGAAAAACTGGCTGACCAGTTCAAACACTTACCGCTTATCGACAAGTACCCAAAC
TGCTTTCCCGATATTAATCCAGTCGACATATACCGCGCGCACATTACAAGCATCCTGCACGACATTACGGGTGTC
GACAAAACCATCATCTACCCGGCTCTGTTATGGCCTGCAACACTGGAAAAGGGGGACCTCACTTTAGCCATACCA
GCTCTCCGCGTCAAGGGAAAGCCTGACGAACTGGGCAAGCAATGGCTGGAAAAGGCAAGTCTTGCAGGCCCTGGT
ATATTGCTCCTCTCTGGCTGACACCATGTCCTGCCATCTAGTGGCCAGAGTCGCCTCTTGTTGAGAAGCCTGTGC
AAACGGGGCCCTTCTTTCCCTTCTTCTTCAAAACCGCACCCTTGACCAAGACGGTTATTCCCATGGCATTGTCCC
ACCGAACAGACTTTGGCGCCAACCGAGCTCTGGGCCTTCGAGACCAAATCGACCCCTCCAAGGGCAGGAAAAGAA
TGATTGTCGAGTTTTCAAGCCCCAACATTGCAAAACCTTTTCATGCCGGTCATTTGCGAAGCACAATCATTGGCG
GCTTTATTTCAAACCTCTATAGAGTTGCAGGATGGGATGTAACAACCATTAACTATCTAGGAGATTGGGGAAAGC
AATACGGCGTGCTAGCCTTGGGCTTTGAAAAATATGGCAACGAGACGGATCTCGAGCAAGATCCCATCAACCATC
TCTTTCATGTCTATGTCAAGATAAGCAAAGATGTGGCTGCTGAGAAGGAGCAGGCTGAGAAACTAAAAACCGAGG
GCAAGGAAGCCGAAGCCAACAAGGTCTTAGAGAAGGGCCTGGACGAACAGGCCCGGCAGTACTTTAAGAGAATGA
CTCAAGGCGATGCCAAGGCATTGGCGCTTTGGAGTCGCTTCCGCGAATTCAGCATCAAGCGCTACAAGGAAACGT
ATGCTCGGCTCAATATTCATTTTGACGAATACTCTGGCGAGAGCAAGGTTTCAGAAGACGACATGCAAAATGCGG
CTGAAAAGATGAAGGAGATTGGATTGGCCGAGGACCATGACGGCGCTCTTCTCATCGACTTTGTCAAGAACATAC
CCGGCAAAGAGGGCAAGCAGTTGGGAAAAGCCATCCTGCGCAAAAAGGATGGCACAGCTCTGTAGGCTGCTAACC
GTGAGGAAGGCTTGTCTCTGGTTCTAACGCTTGACTGTAGTTATCTGACCCGAGATATTTCCGAACTAATGAGCC
GCCACGACCGGTACCACTTTGACCAAATGATATACGTTATTGCCTCGGAGCAAGATCTTCATGTGAAGCAGTTCT
TCAAAGTGAGAGGATACGATTTTCGAAAGACTGTTTGGATTAAATGCTAACGTGGCCCAGGTTGTGTCAATGATG
GGCCATAAGGACATTGCCGATAAGTGCCAACACATCAACTTTGGTCTTGTTCTCGGAATGAGCACTCGAAAAGGT
ATGTGCCGCCTTCTTTTCGTCTTAATGTCTCACTGTGGGCAAGAAAAGCTAATTAGGTTGTTCAAGGGACTGTCA
AGTTTCTTGACGTAAGTTGTTTTGCGGACGGACCTGTTCATGGCAAAAAAGAAGATCTGTTAGTATAGGCTCTGA
CCTTTGATGCAGGACATTCTCAGAGACGTTGGTGATCATATGCACGAGACGATGCGGAAAAATGAAGAAAAATAC
CAGCAAGTCGAAAATCCAGTCAAGACTGCCGATACCCTCGGAATATCTTCGTAGGCATTCTCACAAGACCCAAAA
GGGGGGGAGAAACAAAGCAGCTAATTAATGGTGGGAACAGTGTCATGGTGCAGGACATGCTGGGCAAGCGGTAAG
TCAATAGAGCAGCCGCATACAGCAGCAGACATGTCTAACAGGGTGTAGGATCAACAATTACACATTTGACTTGCA
GAGGATGACAAGTTTTGAAGGCGACACTGGCCCTGTGAGTCTCGAGGAGACTTTGCTTTTTCTGTCTTTTTTTTT
CGTTTTGTTGGAGTTGAGCTGACAGTCGTACTAGTATCTCCAATATGCGCATGCGCGACTGTGCTCCATTACGCG
CAAGGCCGGACTGTCTGAAGAGGATCTCGAATCAGCGGATCTGTCCCTGTTGACAGAGCCCATGGCCATTAATCT
GGTTCGCGTAATCAGCCAATGGCCTGATGTGGTGCAAAATACGCTTCGCACACTGGAGCCTACTACAGTTCTTAC
GTGAGTCGAACAGCACTTCGAGACACAAGTCCATTTAGAAATACATGGGCACAGTGTCTCTCCTTGACATGTCAA
GTTATTGAGAGGCTAACGACTGGCAGATATCTCTTCAAGATGACTCATGTGCTCAGCACGAGCTACAGCCACCTT
CGGATCGTGGGAAGCGAGCCTGAAGTAATGAAGGCGCGAATGGCCTTGTACGATGCAGCGCGAGTCGTACTGTAC
AATGGCATGCGGTTGCTTGGACTTTCGCCATTGGAGAGAATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail