Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4338
Gene name
LocationContig_36:8310..8830
Strand+
Gene length (bp)520
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.1E-17 11 84
PF16367 RRM_7 RNA recognition motif 1.4E-07 10 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 8 141 3.0E-25
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 8 118 1.0E-24
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 8 118 1.0E-24
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 8 118 1.0E-24
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 8 118 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 8 141 3.0E-25
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 8 118 1.0E-24
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 8 118 1.0E-24
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 8 118 1.0E-24
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 8 118 2.0E-24
sp|P0C1I2|PPIE_RHIO9 Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp10 PE=3 SV=1 8 131 5.0E-24
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 8 126 3.0E-22
sp|O94359|YHOC_SCHPO Uncharacterized RNA-binding protein C428.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.12c PE=3 SV=2 6 97 2.0E-17
sp|Q26548|PPIE_SCHMA Peptidyl-prolyl cis-trans isomerase E OS=Schistosoma mansoni PE=1 SV=2 50 116 2.0E-14
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 8 121 1.0E-09
sp|Q499V6|ZCRB1_RAT Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Rattus norvegicus GN=Zcrb1 PE=2 SV=1 8 121 2.0E-09
sp|Q9CZ96|ZCRB1_MOUSE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Mus musculus GN=Zcrb1 PE=1 SV=1 8 121 2.0E-09
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 9 86 3.0E-09
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 11 90 6.0E-09
sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus GN=ZCRB1 PE=2 SV=1 8 121 9.0E-09
sp|Q8TBF4|ZCRB1_HUMAN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens GN=ZCRB1 PE=1 SV=2 8 121 9.0E-09
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 10 108 1.0E-08
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 9 89 1.0E-08
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 9 97 2.0E-08
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 6 86 3.0E-08
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 1 92 4.0E-08
sp|Q5SP50|ZCRB1_DANRE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Danio rerio GN=zcrb1 PE=2 SV=1 8 121 4.0E-08
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 4 98 4.0E-08
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 9 89 5.0E-08
sp|Q9XFR5|SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana GN=SR30 PE=1 SV=1 4 94 5.0E-08
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 9 89 5.0E-08
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 9 89 5.0E-08
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 10 91 6.0E-08
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 1 92 7.0E-08
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 10 101 7.0E-08
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 1 92 7.0E-08
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 1 98 8.0E-08
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 11 92 8.0E-08
sp|Q6PG31|RNPS1_DANRE RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1 11 88 8.0E-08
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 1 92 9.0E-08
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 1 92 9.0E-08
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 1 92 9.0E-08
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 10 91 1.0E-07
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 11 91 1.0E-07
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 11 92 1.0E-07
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 1 92 1.0E-07
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 11 89 2.0E-07
sp|P40565|IST3_YEAST U2 snRNP component IST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST3 PE=1 SV=1 9 95 2.0E-07
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 1 93 3.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 11 98 4.0E-07
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 1 92 4.0E-07
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 1 92 4.0E-07
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 11 91 4.0E-07
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 11 92 5.0E-07
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 11 92 5.0E-07
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 9 101 5.0E-07
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 1 92 5.0E-07
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 11 92 6.0E-07
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 9 114 7.0E-07
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 11 92 8.0E-07
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 11 86 9.0E-07
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 2 98 1.0E-06
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 6 97 1.0E-06
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 2 86 1.0E-06
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 11 90 1.0E-06
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 11 98 1.0E-06
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 11 86 2.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 9 101 2.0E-06
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 1 90 2.0E-06
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 11 86 2.0E-06
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 11 86 2.0E-06
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 11 86 2.0E-06
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 11 86 2.0E-06
sp|A6QR16|RNPS1_BOVIN RNA-binding protein with serine-rich domain 1 OS=Bos taurus GN=RNPS1 PE=2 SV=1 11 88 2.0E-06
sp|Q15287|RNPS1_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens GN=RNPS1 PE=1 SV=1 11 88 2.0E-06
sp|Q4R5N1|RNPS1_MACFA RNA-binding protein with serine-rich domain 1 OS=Macaca fascicularis GN=RNPS1 PE=2 SV=1 11 88 2.0E-06
sp|Q99M28|RNPS1_MOUSE RNA-binding protein with serine-rich domain 1 OS=Mus musculus GN=Rnps1 PE=2 SV=1 11 88 2.0E-06
sp|Q5NVM8|RNPS1_PONAB RNA-binding protein with serine-rich domain 1 OS=Pongo abelii GN=RNPS1 PE=2 SV=1 11 88 2.0E-06
sp|Q6AYK1|RNPS1_RAT RNA-binding protein with serine-rich domain 1 OS=Rattus norvegicus GN=Rnps1 PE=2 SV=1 11 89 2.0E-06
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 11 91 2.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 10 91 2.0E-06
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 9 86 3.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 11 86 3.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 9 90 3.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 9 86 3.0E-06
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 11 89 4.0E-06
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 9 86 5.0E-06
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 8 98 5.0E-06
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 2 98 6.0E-06
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 2 101 6.0E-06
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 10 91 6.0E-06
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 9 86 6.0E-06
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 11 92 7.0E-06
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 11 95 7.0E-06
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 11 90 9.0E-06
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 11 89 9.0E-06
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 11 89 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4338
MADASRWKATVFVGGLSQMVTNSNIYDAFIPFGEIVEVQMPKPDSQQNSSDAHRGFAYVQFEDPEDAVEAIDNMN
QSEFFGRILKVSAAKPPKRADEGLGSKRAVWEQEGWLAEHAGEQGNEEAMEQGKTDREKVPDPMQGLEELDVAGP
RPA*
Coding >OphauG2|4338
ATGGCGGATGCAAGCCGTTGGAAAGCTACCGTCTTTGTTGGTGGGCTATCGCAGATGGTCACGAACAGCAACATC
TACGACGCATTTATCCCCTTTGGCGAAATTGTTGAAGTACAAATGCCGAAACCCGACTCACAGCAAAACTCATCT
GACGCCCATAGAGGCTTTGCCTACGTGCAATTTGAGGATCCAGAGGACGCCGTTGAAGCCATCGACAACATGAAC
CAGTCAGAATTTTTTGGGAGAATACTCAAAGTCTCAGCTGCAAAGCCGCCGAAAAGGGCAGATGAAGGCCTGGGC
AGCAAGAGAGCTGTATGGGAGCAGGAAGGCTGGTTGGCAGAACATGCAGGCGAACAAGGAAATGAAGAGGCAATG
GAACAAGGTAAAACGGACAGAGAAAAGGTCCCTGATCCTATGCAAGGGCTCGAGGAGTTGGATGTTGCAGGGCCA
CGACCAGCATGA
Transcript >OphauG2|4338
ATGGCGGATGCAAGCCGTTGGAAAGCTACCGTCTTTGTTGGTGGGCTATCGCAGATGGTCACGAACAGCAACATC
TACGACGCATTTATCCCCTTTGGCGAAATTGTTGAAGTACAAATGCCGAAACCCGACTCACAGCAAAACTCATCT
GACGCCCATAGAGGCTTTGCCTACGTGCAATTTGAGGATCCAGAGGACGCCGTTGAAGCCATCGACAACATGAAC
CAGTCAGAATTTTTTGGGAGAATACTCAAAGTCTCAGCTGCAAAGCCGCCGAAAAGGGCAGATGAAGGCCTGGGC
AGCAAGAGAGCTGTATGGGAGCAGGAAGGCTGGTTGGCAGAACATGCAGGCGAACAAGGAAATGAAGAGGCAATG
GAACAAGGTAAAACGGACAGAGAAAAGGTCCCTGATCCTATGCAAGGGCTCGAGGAGTTGGATGTTGCAGGGCCA
CGACCAGCATGA
Gene >OphauG2|4338
ATGGCGGATGCAAGCCGTTGGAAAGCTACCGTCTTTGTTGGTGGGCTATCGCAGATGGTCACGAACAGCAACATC
TACGACGCATTTATCCCCTTTGGCGAAATTGTTGAAGTACAAATGCCGAAACCCGACTCACAGCAAAACTCATCT
GACGCCCATAGAGGCTTTGCCTACGTGCAATTTGAGGATCCAGAGGACGCCGTTGAAGCCATCGACAACATGAAC
CAGTCAGAATTTTTTGGGAGAATACTCAAAGTCTCAGCTGCAAAGCCGCCGAAAAGGGCAGATGAAGGCCTGGGC
AGCAAGAGAGCTGTATGGGAGCAGGTGAGCTTGGCACCATAGCATCATGACGACAGGCCCAAAACTAATCTCAAC
TTCTCAGGAAGGCTGGTTGGCAGAACATGCAGGCGAACAAGGAAATGAAGAGGCAATGGAACAAGGTAAAACGGA
CAGAGAAAAGGTCCCTGATCCTATGCAAGGGCTCGAGGAGTTGGATGTTGCAGGGCCACGACCAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail