Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4329
Gene name
LocationContig_358:1418..2829
Strand-
Gene length (bp)1411
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.0E-44 5 335
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 4.2E-07 166 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 1 416 5.0E-74
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 3 324 1.0E-63
sp|Q9ST63|NDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=1 SV=1 3 417 3.0E-63
sp|M0ZYF3|INDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=3 SV=1 3 417 1.0E-62
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 3 324 1.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 1 416 5.0E-74
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 3 324 1.0E-63
sp|Q9ST63|NDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=1 SV=1 3 417 3.0E-63
sp|M0ZYF3|INDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=3 SV=1 3 417 1.0E-62
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 3 324 1.0E-62
sp|Q1JPL4|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 6 324 6.0E-60
sp|Q94BV7|NDB2_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 3 336 2.0E-58
sp|Q9SKT7|NDB4_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 1 348 8.0E-55
sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 2 416 9.0E-55
sp|O80874|NDA2_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=2 SV=1 3 417 9.0E-54
sp|Q8GWA1|NDA1_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 3 417 1.0E-53
sp|F4JJJ3|NDB3_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 3 336 1.0E-52
sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 2 417 2.0E-51
sp|P32340|NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDI1 PE=1 SV=1 3 406 7.0E-46
sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 3 417 4.0E-45
sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 3 405 7.0E-44
sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 1 405 7.0E-38
sp|Q2YWP9|Y807_STAAB NADH dehydrogenase-like protein SAB0807 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0807 PE=3 SV=1 3 373 5.0E-25
sp|Q5HHE4|Y944_STAAC NADH dehydrogenase-like protein SACOL0944 OS=Staphylococcus aureus (strain COL) GN=SACOL0944 PE=3 SV=1 3 373 6.0E-25
sp|Q7A6J4|Y802_STAAN NADH dehydrogenase-like protein SA0802 OS=Staphylococcus aureus (strain N315) GN=SA0802 PE=1 SV=1 3 373 6.0E-25
sp|Q2FID4|Y844_STAA3 NADH dehydrogenase-like protein SAUSA300_0844 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0844 PE=3 SV=1 3 373 6.0E-25
sp|Q2FZV7|Y878_STAA8 NADH dehydrogenase-like protein SAOUHSC_00878 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00878 PE=1 SV=1 3 373 6.0E-25
sp|Q99VE0|Y941_STAAM NADH dehydrogenase-like protein SAV0941 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0941 PE=3 SV=1 3 373 6.0E-25
sp|Q6GIE7|Y903_STAAR NADH dehydrogenase-like protein SAR0903 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0903 PE=3 SV=1 3 373 6.0E-25
sp|Q8NXG0|Y823_STAAW NADH dehydrogenase-like protein MW0823 OS=Staphylococcus aureus (strain MW2) GN=MW0823 PE=3 SV=1 3 373 6.0E-24
sp|Q6GAY5|Y811_STAAS NADH dehydrogenase-like protein SAS0811 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0811 PE=3 SV=1 3 373 6.0E-24
sp|Q4L4V6|Y2010_STAHJ NADH dehydrogenase-like protein SH2010 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2010 PE=3 SV=1 3 368 9.0E-24
sp|P00393|DHNA_ECOLI NADH dehydrogenase OS=Escherichia coli (strain K12) GN=ndh PE=1 SV=2 15 335 6.0E-23
sp|Q49W80|Y1834_STAS1 NADH dehydrogenase-like protein SSP1834 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1834 PE=3 SV=1 3 368 3.0E-21
sp|Q8CPV5|Y635_STAES NADH dehydrogenase-like protein SE_0635 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0635 PE=3 SV=1 3 368 2.0E-20
sp|Q5HQM1|Y527_STAEQ NADH dehydrogenase-like protein SERP0527 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0527 PE=3 SV=1 3 368 4.0E-20
sp|O05267|YUMB_BACSU NADH dehydrogenase-like protein YumB OS=Bacillus subtilis (strain 168) GN=yumB PE=3 SV=1 1 372 1.0E-18
sp|P44856|DHNA_HAEIN NADH dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ndh PE=3 SV=1 25 357 2.0E-18
sp|Q8GXR9|DHNA_ARATH Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=NDC1 PE=1 SV=2 8 370 8.0E-14
sp|O32117|YUTJ_BACSU NADH dehydrogenase-like protein YutJ OS=Bacillus subtilis (strain 168) GN=yutJ PE=3 SV=2 4 344 2.0E-13
sp|P80861|YJLD_BACSU NADH dehydrogenase-like protein YjlD OS=Bacillus subtilis (strain 168) GN=yjlD PE=1 SV=3 6 342 6.0E-10
sp|P9WJJ0|Y1812_MYCTO NADH dehydrogenase-like protein MT1860 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1860 PE=2 SV=1 105 317 2.0E-06
sp|P9WJJ1|Y1812_MYCTU NADH dehydrogenase-like protein Rv1812c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1812c PE=1 SV=1 105 317 2.0E-06
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 317 417 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4329
MAKESLVIVGTGWAGYTLSQKLDDKKYDITIISPEDTSPYTPLLASAACGLFDFSLAEEPVRHKHIKLEYYQARV
ESVDFERKVCTCRPAVQTNGVKADAFEIGYDRLVLAPGCVTNTFNTPGVEEYGYFVRNVNDAKRVQRQMRALVER
ASIPGLSDEQQRALLHIVIVGGGPTGVELSAEMSDLFSQDYSTLYPKLRGKMRISLHDAGHEILGNAFEASLREY
AMASFTKRGVEIVTDSRITEVGQDSIATKKLGHQPCGMVIWATGNKICPLVEKLDVAKAKAGMPRIQTDACLRVK
ATDGSVMQDVFALGDAADVEKQSLPTTAEVAVQKAEYLASALNRSDFSQPFEYRQKALVAYIGGHDGVVSGKPTW
SGAEAWAAWRSKNLLWTRSWRRKVMIMANWVLDLINGKEIARA*
Coding >OphauG2|4329
ATGGCTAAAGAATCTCTCGTCATTGTGGGCACTGGGTGGGCTGGCTATACCCTGTCCCAAAAATTAGACGACAAA
AAGTACGACATTACCATTATTTCACCAGAGGACACGAGTCCCTATACCCCGTTGCTGGCCAGCGCGGCTTGTGGT
CTATTCGACTTTTCTCTTGCCGAGGAGCCGGTAAGACACAAGCATATCAAACTAGAATACTACCAAGCTCGTGTG
GAGAGTGTCGACTTTGAGCGGAAAGTGTGTACTTGCCGACCAGCTGTGCAAACCAATGGAGTCAAGGCAGATGCG
TTTGAGATTGGCTATGATAGGCTTGTGCTCGCGCCCGGGTGTGTGACCAATACCTTCAATACGCCAGGGGTGGAA
GAGTATGGCTACTTTGTGCGCAACGTGAATGACGCCAAGAGGGTGCAGCGGCAGATGAGGGCGCTGGTGGAGAGG
GCGTCGATTCCAGGACTCTCGGATGAGCAGCAGCGAGCCTTGTTGCACATTGTCATTGTGGGCGGAGGGCCCACG
GGGGTCGAGCTCTCTGCCGAGATGTCGGACCTGTTCAGCCAGGACTATTCGACGCTGTACCCCAAGCTCCGCGGC
AAGATGCGCATCTCGCTTCACGATGCGGGCCATGAGATTCTGGGAAACGCATTTGAGGCTTCGCTGCGGGAATAC
GCCATGGCCAGCTTCACCAAGAGAGGCGTTGAGATTGTCACCGACTCGAGAATCACCGAGGTGGGCCAGGACAGC
ATTGCTACCAAGAAACTAGGCCATCAGCCCTGCGGCATGGTCATCTGGGCCACGGGAAACAAGATTTGCCCGCTG
GTTGAGAAGCTTGATGTGGCCAAGGCCAAGGCGGGAATGCCTCGGATCCAGACGGATGCCTGCTTGCGCGTCAAG
GCAACCGACGGCAGCGTGATGCAAGACGTCTTTGCGCTGGGCGATGCCGCCGACGTGGAGAAGCAGTCTCTGCCG
ACAACAGCCGAGGTTGCGGTGCAAAAGGCCGAATATCTCGCCTCGGCCCTCAACAGGAGCGACTTTAGCCAGCCC
TTTGAGTACCGGCAAAAGGCCTTGGTGGCGTACATTGGGGGCCATGATGGCGTTGTCAGTGGAAAGCCTACTTGG
TCTGGGGCCGAAGCCTGGGCTGCGTGGCGGAGCAAGAATCTGTTGTGGACGAGGAGTTGGCGGCGCAAGGTCATG
ATTATGGCCAACTGGGTGCTTGACTTGATTAACGGCAAGGAGATAGCTCGAGCGTAA
Transcript >OphauG2|4329
ATGGCTAAAGAATCTCTCGTCATTGTGGGCACTGGGTGGGCTGGCTATACCCTGTCCCAAAAATTAGACGACAAA
AAGTACGACATTACCATTATTTCACCAGAGGACACGAGTCCCTATACCCCGTTGCTGGCCAGCGCGGCTTGTGGT
CTATTCGACTTTTCTCTTGCCGAGGAGCCGGTAAGACACAAGCATATCAAACTAGAATACTACCAAGCTCGTGTG
GAGAGTGTCGACTTTGAGCGGAAAGTGTGTACTTGCCGACCAGCTGTGCAAACCAATGGAGTCAAGGCAGATGCG
TTTGAGATTGGCTATGATAGGCTTGTGCTCGCGCCCGGGTGTGTGACCAATACCTTCAATACGCCAGGGGTGGAA
GAGTATGGCTACTTTGTGCGCAACGTGAATGACGCCAAGAGGGTGCAGCGGCAGATGAGGGCGCTGGTGGAGAGG
GCGTCGATTCCAGGACTCTCGGATGAGCAGCAGCGAGCCTTGTTGCACATTGTCATTGTGGGCGGAGGGCCCACG
GGGGTCGAGCTCTCTGCCGAGATGTCGGACCTGTTCAGCCAGGACTATTCGACGCTGTACCCCAAGCTCCGCGGC
AAGATGCGCATCTCGCTTCACGATGCGGGCCATGAGATTCTGGGAAACGCATTTGAGGCTTCGCTGCGGGAATAC
GCCATGGCCAGCTTCACCAAGAGAGGCGTTGAGATTGTCACCGACTCGAGAATCACCGAGGTGGGCCAGGACAGC
ATTGCTACCAAGAAACTAGGCCATCAGCCCTGCGGCATGGTCATCTGGGCCACGGGAAACAAGATTTGCCCGCTG
GTTGAGAAGCTTGATGTGGCCAAGGCCAAGGCGGGAATGCCTCGGATCCAGACGGATGCCTGCTTGCGCGTCAAG
GCAACCGACGGCAGCGTGATGCAAGACGTCTTTGCGCTGGGCGATGCCGCCGACGTGGAGAAGCAGTCTCTGCCG
ACAACAGCCGAGGTTGCGGTGCAAAAGGCCGAATATCTCGCCTCGGCCCTCAACAGGAGCGACTTTAGCCAGCCC
TTTGAGTACCGGCAAAAGGCCTTGGTGGCGTACATTGGGGGCCATGATGGCGTTGTCAGTGGAAAGCCTACTTGG
TCTGGGGCCGAAGCCTGGGCTGCGTGGCGGAGCAAGAATCTGTTGTGGACGAGGAGTTGGCGGCGCAAGGTCATG
ATTATGGCCAACTGGGTGCTTGACTTGATTAACGGCAAGGAGATAGCTCGAGCGTAA
Gene >OphauG2|4329
ATGGCTAAAGAATCTCTCGTCATTGTGGGCACTGGGTGGGCTGGCTATACCCTGTCCCAAAAATTAGACGACAAA
AAGTACGACATTACCATTATTTCACCAGAGGACACGAGTCCCTATACCCCGTTGCTGGTAAGCAAATATGATATC
CTTGATCCTTTATGGAACAAGAGAAAAGAAGTGGGCAGCTGAGCTGACCTTGGCATATGCAAATATGTAGGCCAG
CGCGGCTTGTGGTCTATTCGACTTTTCTCTTGCCGAGGAGCCGGTAAGACACAAGCATATCAAACTAGAATACTA
CCAAGCTCGTGTGGAGAGTGTCGACTTTGAGCGGAAAGTGTGTACTTGCCGACCAGCTGTGCAAACCAATGGAGT
CAAGGCAGATGCGTTTGAGATTGGCTATGATAGGCTTGTGCTCGCGCCCGGGTAAGAAACAAGATTGACAACTCG
GCATGTATGGATGCAGGACTAACAAAAGGCCATTACATGTAGGTGTGTGACCAATACCTTCAATACGCCAGGGGT
GGAAGAGTATGGCTACTTTGTGCGCAACGTGAATGACGCCAAGAGGGTGCAGCGGCAGATGAGGGCGCTGGTGGA
GAGGGCGTCGATTCCAGGACTCTCGGATGAGCAGCAGCGAGCCTTGTTGCACATTGTCATTGTGGGCGGAGGGCC
CACGGGGGTCGAGCTCTCTGCCGAGATGTCGGACCTGTTCAGCCAGGACTATTCGACGCTGTACCCCAAGCTCCG
CGGCAAGATGCGCATCTCGCTTCACGATGCGGGCCATGAGATTCTGGGAAACGCATTTGAGGCTTCGCTGCGGGA
ATACGCCATGGCCAGCTTCACCAAGAGAGGCGTTGAGATTGTCACCGACTCGAGAATCACCGAGGTGGGCCAGGA
CAGCATTGCTACCAAGAAACTAGGCCATCAGCCCTGCGGCATGGTCATCTGGGCCACGGGAAACAAGATTTGCCC
GCTGGTTGAGAAGCTTGATGTGGCCAAGGCCAAGGCGGGAATGCCTCGGATCCAGACGGATGCCTGCTTGCGCGT
CAAGGCAACCGACGGCAGCGTGATGCAAGACGTCTTTGCGCTGGGCGATGCCGCCGACGTGGAGAAGCAGTCTCT
GCCGACAACAGCCGAGGTTGCGGTGCAAAAGGCCGAATATCTCGCCTCGGCCCTCAACAGGAGCGACTTTAGCCA
GCCCTTTGAGTACCGGCAAAAGGCCTTGGTGGCGTACATTGGGGGCCATGATGGCGTTGTCAGTGGAAAGCCTAC
TTGGTCTGGGGCCGAAGCCTGGGCTGCGTGGCGGAGCAAGAATCTGTTGTGGACGAGGAGTTGGCGGCGCAAGGT
CATGATTATGGCCAACTGGGTGCTTGACTTGATTAACGGCAAGGAGATAGCTCGAGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail