Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4316
Gene name
LocationContig_356:9072..11079
Strand-
Gene length (bp)2007
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 5.7E-23 58 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 63 242 1.0E-10
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 52 239 1.0E-09
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 52 239 2.0E-09
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 54 242 2.0E-09
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 63 173 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 63 242 1.0E-10
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 52 239 1.0E-09
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 52 239 2.0E-09
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 54 242 2.0E-09
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 63 173 6.0E-09
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 62 239 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup83
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1374
Ophiocordyceps australis 1348a (Ghana) OphauG2|4316 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1748
Ophiocordyceps australis map64 (Brazil) OphauB2|3388
Ophiocordyceps australis map64 (Brazil) OphauB2|5960
Ophiocordyceps australis map64 (Brazil) OphauB2|7006
Ophiocordyceps camponoti-rufipedis Ophun1|3943
Ophiocordyceps subramaniannii Hirsu2|1949
Ophiocordyceps subramaniannii Hirsu2|556
Ophiocordyceps subramaniannii Hirsu2|7331
Ophiocordyceps subramaniannii Hirsu2|8399
Ophiocordyceps subramaniannii Hirsu2|9233
Ophiocordyceps subramaniannii Hirsu2|9234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4316
MGNSNASPAPQSPPSFGSQPVPPLGPPLPNLPGPLDPIQPATKPEHRIQIEAESMLVSPEIVFRGESASPAQVKS
RGGFAPRTHFQSPDAFKLWPVQLQRERGVVIDTAYVSTSRYFEVARSYPPGGLNRYVYCIRGTPNMVDVAASLGP
HLLVDEAEFAALGGIHWTQVIGWIEASDIRDDYLVDEFSNDNFDRLKSQGKLHENPDYDVKWDKFTAGRAAPELV
GFPQGHVARSQAPWNAFLDKPVKDYALDLIRPNMGVLGFGRDFPLQLQAERLKPAHIVFYGDYLWPKEAKRQGGF
RTSADGISKLRPLSVTAYSINTMRNQEKLGRHPESYFLATHDMFGAAAADAAAKAAKFGGQFHPIVYTVHATPNM
VRAGNKIAAAGGIVWSQVMAWTQVPHGYSLPQQSVPWRQQMLDHFKEAHERGIGRLFEENPDYDPKFDQYTSNQS
PQPQLFGERNAQRNLINFIKENGQAVGFGDKFPLVNAPQATYTQDSALEEAHNAETAPHKPGFFERISAFVKNNK
VATALLPAVAVANLVPGLGEIVDAAEWAALSTSAVEEAGLTLEGVGVAMAGEESTVAGAQVVMGDTEIVEAQQAV
AESIGGRIGRRVGENVGKSVEEGVRESVRHGVGNKDQSILDALSRAPKVPSHVPGGKPGRIKVVEKSS*
Coding >OphauG2|4316
ATGGGCAATTCCAACGCTTCACCAGCACCTCAGAGCCCGCCATCGTTTGGTAGTCAGCCTGTTCCGCCCCTTGGC
CCGCCCCTCCCAAACCTACCTGGCCCATTGGACCCTATTCAGCCTGCGACGAAGCCAGAGCATCGAATCCAAATC
GAGGCAGAATCTATGCTTGTATCACCTGAAATTGTATTTCGAGGAGAATCAGCTTCGCCTGCCCAAGTCAAGTCT
CGCGGCGGCTTTGCTCCACGGACTCATTTCCAGTCCCCAGATGCCTTCAAGCTGTGGCCGGTTCAGCTTCAGAGA
GAGCGCGGCGTCGTGATTGATACGGCATATGTGTCCACTTCTCGCTACTTTGAAGTTGCGCGCAGCTACCCCCCC
GGCGGCCTCAACCGCTATGTTTACTGCATCCGTGGCACGCCAAACATGGTGGACGTGGCTGCTTCCCTGGGACCG
CATCTTCTTGTTGACGAGGCAGAATTTGCTGCGCTAGGCGGGATTCATTGGACGCAGGTCATTGGCTGGATTGAG
GCATCTGATATAAGAGACGACTATCTCGTCGACGAGTTTAGCAACGACAACTTTGACCGGCTCAAGAGCCAGGGA
AAGCTTCATGAGAATCCAGACTACGATGTGAAATGGGACAAATTCACGGCTGGAAGAGCCGCGCCAGAACTAGTT
GGATTCCCCCAAGGCCATGTCGCACGAAGCCAAGCGCCATGGAACGCGTTCCTCGACAAGCCAGTCAAGGACTAT
GCTCTAGACCTCATCAGGCCCAACATGGGTGTTCTCGGCTTTGGCAGAGACTTTCCGCTCCAGCTCCAGGCCGAG
AGACTCAAGCCGGCCCACATTGTCTTTTACGGAGACTACCTGTGGCCAAAAGAGGCCAAGAGACAGGGCGGCTTC
CGCACCTCTGCCGATGGCATCTCCAAACTGAGGCCACTTTCAGTGACTGCGTATAGCATCAATACTATGCGAAAT
CAAGAAAAACTTGGCCGGCACCCTGAATCATACTTCCTCGCGACCCACGACATGTTTGGCGCGGCAGCGGCAGAC
GCAGCGGCCAAGGCAGCCAAGTTTGGCGGCCAGTTCCACCCCATTGTCTACACAGTCCACGCAACGCCAAACATG
GTGCGAGCCGGCAACAAGATTGCGGCAGCGGGAGGCATCGTATGGTCTCAGGTCATGGCATGGACTCAAGTGCCC
CATGGCTACTCGCTGCCTCAGCAGAGCGTGCCTTGGAGGCAACAAATGTTGGACCACTTCAAGGAGGCGCATGAG
CGTGGTATCGGGAGGCTGTTTGAGGAGAATCCAGACTACGACCCCAAGTTTGATCAATACACGTCTAATCAGAGC
CCGCAGCCTCAGCTATTTGGTGAGAGAAACGCGCAACGAAACCTCATCAATTTCATCAAGGAAAATGGTCAGGCT
GTTGGCTTTGGAGACAAGTTTCCTCTAGTCAATGCTCCTCAAGCCACCTACACCCAAGACTCTGCGCTGGAGGAA
GCACACAATGCCGAGACTGCACCACACAAACCAGGCTTCTTTGAAAGAATCTCCGCCTTTGTCAAAAACAATAAA
GTTGCTACTGCCCTGCTGCCAGCCGTTGCGGTAGCCAACCTCGTTCCTGGGCTGGGAGAAATTGTCGATGCTGCA
GAGTGGGCCGCCTTGAGTACCAGTGCTGTTGAGGAGGCGGGTCTCACACTCGAGGGCGTGGGCGTAGCAATGGCT
GGAGAAGAGTCTACAGTGGCGGGAGCACAAGTTGTCATGGGTGACACGGAGATAGTAGAAGCGCAACAAGCAGTA
GCAGAGAGTATAGGAGGAAGAATAGGAAGACGCGTAGGAGAGAATGTAGGAAAAAGCGTTGAGGAGGGTGTCAGA
GAGAGTGTCAGACATGGCGTTGGCAACAAGGACCAGAGCATATTAGATGCACTATCCAGAGCTCCCAAGGTGCCA
AGCCATGTGCCTGGTGGCAAACCTGGACGCATCAAGGTTGTGGAAAAGAGCTCTTGA
Transcript >OphauG2|4316
ATGGGCAATTCCAACGCTTCACCAGCACCTCAGAGCCCGCCATCGTTTGGTAGTCAGCCTGTTCCGCCCCTTGGC
CCGCCCCTCCCAAACCTACCTGGCCCATTGGACCCTATTCAGCCTGCGACGAAGCCAGAGCATCGAATCCAAATC
GAGGCAGAATCTATGCTTGTATCACCTGAAATTGTATTTCGAGGAGAATCAGCTTCGCCTGCCCAAGTCAAGTCT
CGCGGCGGCTTTGCTCCACGGACTCATTTCCAGTCCCCAGATGCCTTCAAGCTGTGGCCGGTTCAGCTTCAGAGA
GAGCGCGGCGTCGTGATTGATACGGCATATGTGTCCACTTCTCGCTACTTTGAAGTTGCGCGCAGCTACCCCCCC
GGCGGCCTCAACCGCTATGTTTACTGCATCCGTGGCACGCCAAACATGGTGGACGTGGCTGCTTCCCTGGGACCG
CATCTTCTTGTTGACGAGGCAGAATTTGCTGCGCTAGGCGGGATTCATTGGACGCAGGTCATTGGCTGGATTGAG
GCATCTGATATAAGAGACGACTATCTCGTCGACGAGTTTAGCAACGACAACTTTGACCGGCTCAAGAGCCAGGGA
AAGCTTCATGAGAATCCAGACTACGATGTGAAATGGGACAAATTCACGGCTGGAAGAGCCGCGCCAGAACTAGTT
GGATTCCCCCAAGGCCATGTCGCACGAAGCCAAGCGCCATGGAACGCGTTCCTCGACAAGCCAGTCAAGGACTAT
GCTCTAGACCTCATCAGGCCCAACATGGGTGTTCTCGGCTTTGGCAGAGACTTTCCGCTCCAGCTCCAGGCCGAG
AGACTCAAGCCGGCCCACATTGTCTTTTACGGAGACTACCTGTGGCCAAAAGAGGCCAAGAGACAGGGCGGCTTC
CGCACCTCTGCCGATGGCATCTCCAAACTGAGGCCACTTTCAGTGACTGCGTATAGCATCAATACTATGCGAAAT
CAAGAAAAACTTGGCCGGCACCCTGAATCATACTTCCTCGCGACCCACGACATGTTTGGCGCGGCAGCGGCAGAC
GCAGCGGCCAAGGCAGCCAAGTTTGGCGGCCAGTTCCACCCCATTGTCTACACAGTCCACGCAACGCCAAACATG
GTGCGAGCCGGCAACAAGATTGCGGCAGCGGGAGGCATCGTATGGTCTCAGGTCATGGCATGGACTCAAGTGCCC
CATGGCTACTCGCTGCCTCAGCAGAGCGTGCCTTGGAGGCAACAAATGTTGGACCACTTCAAGGAGGCGCATGAG
CGTGGTATCGGGAGGCTGTTTGAGGAGAATCCAGACTACGACCCCAAGTTTGATCAATACACGTCTAATCAGAGC
CCGCAGCCTCAGCTATTTGGTGAGAGAAACGCGCAACGAAACCTCATCAATTTCATCAAGGAAAATGGTCAGGCT
GTTGGCTTTGGAGACAAGTTTCCTCTAGTCAATGCTCCTCAAGCCACCTACACCCAAGACTCTGCGCTGGAGGAA
GCACACAATGCCGAGACTGCACCACACAAACCAGGCTTCTTTGAAAGAATCTCCGCCTTTGTCAAAAACAATAAA
GTTGCTACTGCCCTGCTGCCAGCCGTTGCGGTAGCCAACCTCGTTCCTGGGCTGGGAGAAATTGTCGATGCTGCA
GAGTGGGCCGCCTTGAGTACCAGTGCTGTTGAGGAGGCGGGTCTCACACTCGAGGGCGTGGGCGTAGCAATGGCT
GGAGAAGAGTCTACAGTGGCGGGAGCACAAGTTGTCATGGGTGACACGGAGATAGTAGAAGCGCAACAAGCAGTA
GCAGAGAGTATAGGAGGAAGAATAGGAAGACGCGTAGGAGAGAATGTAGGAAAAAGCGTTGAGGAGGGTGTCAGA
GAGAGTGTCAGACATGGCGTTGGCAACAAGGACCAGAGCATATTAGATGCACTATCCAGAGCTCCCAAGGTGCCA
AGCCATGTGCCTGGTGGCAAACCTGGACGCATCAAGGTTGTGGAAAAGAGCTCTTGA
Gene >OphauG2|4316
ATGGGCAATTCCAACGCTTCACCAGCACCTCAGAGCCCGCCATCGTTTGGTAGTCAGCCTGTTCCGCCCCTTGGC
CCGCCCCTCCCAAACCTACCTGGCCCATTGGACCCTATTCAGCCTGCGACGAAGCCAGAGCATCGAATCCAAATC
GAGGCAGAATCTATGCTTGTATCACCTGAAATTGTATTTCGAGGAGAATCAGCTTCGCCTGCCCAAGTCAAGTCT
CGCGGCGGCTTTGCTCCACGGACTCATTTCCAGTCCCCAGATGCCTTCAAGCTGTGGCCGGTTCAGCTTCAGAGA
GAGCGCGGCGTCGTGATTGATACGGCATATGTGTCCACTTCTCGCTACTTTGAAGTTGCGCGCAGCTACCCCCCC
GGCGGCCTCAACCGCTATGTTTACTGCATCCGTGGCACGCCAAACATGGTGGACGTGGCTGCTTCCCTGGGACCG
CATCTTCTTGTTGACGAGGCAGAATTTGCTGCGCTAGGCGGGATTCATTGGACGCAGGTCATTGGCTGGATTGAG
GCATCTGATATAAGAGACGACTATCTCGTCGACGAGTTTAGCAACGACAACTTTGACCGGCTCAAGAGCCAGGGA
AAGCTTCATGAGAATCCAGACTACGATGTGAAATGGGACAAATTCACGGCTGGAAGAGCCGCGCCAGAACTAGTT
GGATTCCCCCAAGGCCATGTCGCACGAAGCCAAGCGCCATGGAACGCGTTCCTCGACAAGCCAGTCAAGGACTAT
GCTCTAGACCTCATCAGGCCCAACATGGGTGTTCTCGGCTTTGGCAGAGACTTTCCGCTCCAGCTCCAGGCCGAG
AGACTCAAGCCGGCCCACATTGTCTTTTACGGAGACTACCTGTGGCCAAAAGAGGCCAAGAGACAGGGCGGCTTC
CGCACCTCTGCCGATGGCATCTCCAAACTGAGGCCACTTTCAGTGACTGCGTATAGCATCAATACTATGCGAAAT
CAAGAAAAACTTGGCCGGCACCCTGAATCATACTTCCTCGCGACCCACGACATGTTTGGCGCGGCAGCGGCAGAC
GCAGCGGCCAAGGCAGCCAAGTTTGGCGGCCAGTTCCACCCCATTGTCTACACAGTCCACGCAACGCCAAACATG
GTGCGAGCCGGCAACAAGATTGCGGCAGCGGGAGGCATCGTATGGTCTCAGGTCATGGCATGGACTCAAGTGCCC
CATGGCTACTCGCTGCCTCAGCAGAGCGTGCCTTGGAGGCAACAAATGTTGGACCACTTCAAGGAGGCGCATGAG
CGTGGTATCGGGAGGCTGTTTGAGGAGAATCCAGACTACGACCCCAAGTTTGATCAATACACGTCTAATCAGAGC
CCGCAGCCTCAGCTATTTGGTGAGAGAAACGCGCAACGAAACCTCATCAATTTCATCAAGGAAAATGGTCAGGCT
GTTGGCTTTGGAGACAAGTTTCCTCTAGTCAATGCTCCTCAAGCCACCTACACCCAAGACTCTGCGCTGGAGGAA
GCACACAATGCCGAGACTGCACCACACAAACCAGGCTTCTTTGAAAGAATCTCCGCCTTTGTCAAAAACAATAAA
GTTGCTACTGCCCTGCTGCCAGCCGTTGCGGTAGCCAACCTCGTTCCTGGGCTGGGAGAAATTGTCGATGCTGCA
GAGTGGGCCGCCTTGAGTACCAGTGCTGTTGAGGAGGCGGGTCTCACACTCGAGGGCGTGGGCGTAGCAATGGCT
GGAGAAGAGTCTACAGTGGCGGGAGCACAAGTTGTCATGGGTGACACGGAGATAGTAGAAGCGCAACAAGCAGTA
GCAGAGAGTATAGGAGGAAGAATAGGAAGACGCGTAGGAGAGAATGTAGGAAAAAGCGTTGAGGAGGGTGTCAGA
GAGAGTGTCAGACATGGCGTTGGCAACAAGGACCAGAGCATATTAGATGCACTATCCAGAGCTCCCAAGGTGCCA
AGCCATGTGCCTGGTGGCAAACCTGGACGCATCAAGGTTGTGGAAAAGAGCTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail