Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4310
Gene name
LocationContig_355:13850..14333
Strand+
Gene length (bp)483
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 5.2E-10 3 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23599|1A11_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMW33 OS=Cucurbita maxima GN=ACS1 PE=2 SV=1 1 135 3.0E-12
sp|Q00379|1A12_CUCPE 1-aminocyclopropane-1-carboxylate synthase 2 OS=Cucurbita pepo GN=ACS2 PE=2 SV=1 1 135 1.0E-11
sp|Q9MB95|1A11_PRUMU 1-aminocyclopropane-1-carboxylate synthase 1 OS=Prunus mume GN=ACS1 PE=2 SV=1 1 130 1.0E-11
sp|P23279|1A11_CUCPE 1-aminocyclopropane-1-carboxylate synthase 1 OS=Cucurbita pepo GN=ACC1A PE=1 SV=1 1 135 3.0E-11
sp|Q9W698|1A1L1_TAKRU 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Takifugu rubripes GN=accs PE=3 SV=1 3 138 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23599|1A11_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMW33 OS=Cucurbita maxima GN=ACS1 PE=2 SV=1 1 135 3.0E-12
sp|Q00379|1A12_CUCPE 1-aminocyclopropane-1-carboxylate synthase 2 OS=Cucurbita pepo GN=ACS2 PE=2 SV=1 1 135 1.0E-11
sp|Q9MB95|1A11_PRUMU 1-aminocyclopropane-1-carboxylate synthase 1 OS=Prunus mume GN=ACS1 PE=2 SV=1 1 130 1.0E-11
sp|P23279|1A11_CUCPE 1-aminocyclopropane-1-carboxylate synthase 1 OS=Cucurbita pepo GN=ACC1A PE=1 SV=1 1 135 3.0E-11
sp|Q9W698|1A1L1_TAKRU 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Takifugu rubripes GN=accs PE=3 SV=1 3 138 5.0E-11
sp|Q5E9H2|1A1L1_BOVIN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Bos taurus GN=ACCS PE=2 SV=1 3 135 6.0E-11
sp|A2AIG8|1A1L1_MOUSE 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Mus musculus GN=Accs PE=2 SV=1 3 135 8.0E-11
sp|Q9S9U6|1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 1 130 3.0E-10
sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 5 135 6.0E-10
sp|P31531|1A1C_SOYBN 1-aminocyclopropane-1-carboxylate synthase OS=Glycine max GN=ACS1 PE=2 SV=1 1 130 8.0E-10
sp|Q9SAR0|1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana GN=ACS6 PE=1 SV=2 3 130 2.0E-09
sp|Q06429|1A11_ARATH 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Arabidopsis thaliana GN=ACS1 PE=1 SV=2 3 130 2.0E-09
sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 5 130 4.0E-09
sp|Q96QU6|1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens GN=ACCS PE=1 SV=1 3 134 4.0E-09
sp|Q06402|1A12_ARATH 1-aminocyclopropane-1-carboxylate synthase 2 OS=Arabidopsis thaliana GN=ACS2 PE=1 SV=1 1 138 2.0E-08
sp|Q3UX83|1A1L2_MOUSE Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Mus musculus GN=Accsl PE=2 SV=1 5 138 2.0E-08
sp|Q43309|1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 1 130 2.0E-08
sp|Q01912|1A1C_VIGRR 1-aminocyclopropane-1-carboxylate synthase (Fragment) OS=Vigna radiata var. radiata GN=ACS5 PE=2 SV=1 1 117 3.0E-08
sp|P29535|1A14_SOLLC 1-aminocyclopropane-1-carboxylate synthase 4 OS=Solanum lycopersicum GN=ACS4 PE=2 SV=1 1 130 3.0E-08
sp|Q07262|1A1C_TOBAC 1-aminocyclopropane-1-carboxylate synthase OS=Nicotiana tabacum GN=ACS1 PE=2 SV=1 1 130 4.0E-08
sp|P18485|1A12_SOLLC 1-aminocyclopropane-1-carboxylate synthase 2 OS=Solanum lycopersicum GN=ACS2 PE=1 SV=2 3 130 9.0E-08
sp|Q37001|1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 5 130 3.0E-07
sp|Q9M2Y8|1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana GN=ACS9 PE=1 SV=1 5 135 5.0E-07
sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 5 130 6.0E-07
sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 1 130 1.0E-06
sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 1 130 1.0E-06
sp|P27486|1A1C_DIACA 1-aminocyclopropane-1-carboxylate synthase OS=Dianthus caryophyllus GN=ACS2 PE=2 SV=1 1 140 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0009058 biosynthetic process Yes
GO:0019842 vitamin binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0070279 vitamin B6 binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4310
MWANILEDKEFLADFIAKNRQVLAKHCTILRVFLDRHGIPYYTNVYAGVFVWVDLRRYLYGESFGTVNSPETTSS
TTNIHQDREMMFFKYCLASGIAISPGSSFSTEELGWFRLSFAVEEQALHIGLERLLQCLERFKIEY*
Coding >OphauG2|4310
ATGTGGGCAAACATCCTCGAGGATAAGGAGTTCCTGGCCGACTTTATAGCCAAGAACCGTCAAGTGCTAGCAAAG
CATTGCACAATCTTGAGGGTATTCTTGGATCGACATGGAATTCCGTACTATACCAATGTCTATGCCGGTGTTTTT
GTCTGGGTTGATCTGCGCCGCTATTTATACGGAGAATCGTTTGGCACAGTAAATAGCCCAGAGACAACATCGTCT
ACGACCAATATACACCAAGATCGAGAAATGATGTTTTTTAAATACTGTCTCGCGTCAGGTATCGCAATTTCTCCT
GGAAGCAGTTTCTCTACGGAAGAGCTGGGTTGGTTTCGACTAAGCTTTGCCGTCGAGGAGCAGGCTTTACACATC
GGACTTGAAAGATTGCTCCAGTGCTTGGAACGTTTTAAAATAGAGTATTAG
Transcript >OphauG2|4310
ATGTGGGCAAACATCCTCGAGGATAAGGAGTTCCTGGCCGACTTTATAGCCAAGAACCGTCAAGTGCTAGCAAAG
CATTGCACAATCTTGAGGGTATTCTTGGATCGACATGGAATTCCGTACTATACCAATGTCTATGCCGGTGTTTTT
GTCTGGGTTGATCTGCGCCGCTATTTATACGGAGAATCGTTTGGCACAGTAAATAGCCCAGAGACAACATCGTCT
ACGACCAATATACACCAAGATCGAGAAATGATGTTTTTTAAATACTGTCTCGCGTCAGGTATCGCAATTTCTCCT
GGAAGCAGTTTCTCTACGGAAGAGCTGGGTTGGTTTCGACTAAGCTTTGCCGTCGAGGAGCAGGCTTTACACATC
GGACTTGAAAGATTGCTCCAGTGCTTGGAACGTTTTAAAATAGAGTATTAG
Gene >OphauG2|4310
ATGTGGGCAAACATCCTCGAGGATAAGGAGTTCCTGGCCGACTTTATAGCCAAGAACCGTCAAGTGCTAGCAAAG
CATTGCACAATCTTGAGGGTATTCTTGGATCGACATGGAATTCCGTACTATACCAATGTGTAAGCATTTTCAACC
ATGTTTTTATATGCTGCTAATACTAAACTACTTGTTCATAGCTATGCCGGTGTTTTTGTCTGGGTTGATCTGCGC
CGCTATTTATACGGAGAATCGTTTGGCACAGTAAATAGCCCAGAGACAACATCGTCTACGACCAATATACACCAA
GATCGAGAAATGATGTTTTTTAAATACTGTCTCGCGTCAGGTATCGCAATTTCTCCTGGAAGCAGTTTCTCTACG
GAAGAGCTGGGTTGGTTTCGACTAAGCTTTGCCGTCGAGGAGCAGGCTTTACACATCGGACTTGAAAGATTGCTC
CAGTGCTTGGAACGTTTTAAAATAGAGTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail