Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4309
Gene name
LocationContig_355:12575..13437
Strand+
Gene length (bp)862
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 3.2E-06 89 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4AC99|1A1L2_HUMAN Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Homo sapiens GN=ACCSL PE=2 SV=3 48 210 8.0E-14
sp|P37821|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 19 211 3.0E-11
sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 19 211 2.0E-10
sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 19 211 2.0E-10
sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 2 211 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4AC99|1A1L2_HUMAN Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Homo sapiens GN=ACCSL PE=2 SV=3 48 210 8.0E-14
sp|P37821|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 19 211 3.0E-11
sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 19 211 2.0E-10
sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 19 211 2.0E-10
sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 2 211 7.0E-10
sp|Q3UX83|1A1L2_MOUSE Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Mus musculus GN=Accsl PE=2 SV=1 9 171 5.0E-09
sp|Q5E9H2|1A1L1_BOVIN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Bos taurus GN=ACCS PE=2 SV=1 33 216 2.0E-08
sp|Q9S9U6|1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 48 211 4.0E-08
sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 48 211 4.0E-08
sp|P27486|1A1C_DIACA 1-aminocyclopropane-1-carboxylate synthase OS=Dianthus caryophyllus GN=ACS2 PE=2 SV=1 45 211 4.0E-07
sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 19 211 8.0E-07
sp|Q96QU6|1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens GN=ACCS PE=1 SV=1 33 216 8.0E-07
sp|Q06429|1A11_ARATH 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Arabidopsis thaliana GN=ACS1 PE=1 SV=2 48 211 1.0E-06
sp|Q37001|1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 24 176 2.0E-06
sp|A2AIG8|1A1L1_MOUSE 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Mus musculus GN=Accs PE=2 SV=1 33 149 2.0E-06
sp|P29535|1A14_SOLLC 1-aminocyclopropane-1-carboxylate synthase 4 OS=Solanum lycopersicum GN=ACS4 PE=2 SV=1 47 211 3.0E-06
sp|Q9SAR0|1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana GN=ACS6 PE=1 SV=2 47 211 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0009058 biosynthetic process Yes
GO:0019842 vitamin binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0070279 vitamin B6 binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4309
MATPASHAQASLAGARYGLSERAAYNSLQDQPWDTIEKMMTNIWSPDNTNGLVHLGVAENTLLYKEVATHINNSS
TIIPDHHLGYGVGPRGSPRLKKALVSFFNSEFRAHEPVLEKEILILPGVMALIDALAWSICNDGEGIIVPVPFYT
GFKPATSTRARGVLVPASIQSVGKYQCLDDVFDPEINRKALEDALLRATQNGVKVRAVMLTKYEIPKLRKLFNLE
PPLTHDAPVLITRWEDAM*
Coding >OphauG2|4309
ATGGCCACTCCAGCTTCACATGCCCAGGCTAGTCTTGCTGGCGCGAGATACGGACTATCCGAGAGAGCTGCCTAT
AATTCTCTTCAAGACCAGCCATGGGATACAATTGAAAAGATGATGACCAACATTTGGTCGCCAGATAACACTAAC
GGCTTAGTGCATCTAGGTGTGGCGGAGAATACTCTCCTATATAAAGAAGTGGCCACGCATATTAACAACAGCTCA
ACAATCATCCCAGACCATCATCTAGGCTATGGAGTAGGCCCAAGAGGATCCCCACGTCTAAAAAAGGCCCTGGTG
TCGTTTTTCAACTCGGAATTCCGCGCACATGAGCCTGTATTGGAAAAGGAGATTCTCATTCTCCCTGGTGTTATG
GCTTTAATTGACGCTTTGGCGTGGTCAATCTGCAATGACGGCGAGGGTATTATTGTTCCGGTGCCTTTCTATACT
GGCTTCAAGCCGGCCACGTCTACAAGAGCGCGCGGAGTACTCGTGCCCGCGTCAATCCAGTCCGTTGGAAAATAC
CAGTGCCTGGATGATGTCTTTGACCCCGAGATTAACAGAAAAGCGTTGGAAGACGCACTTCTCCGGGCTACCCAA
AATGGCGTCAAGGTGCGCGCTGTAATGTTGACCAAGTATGAGATCCCCAAGTTGCGGAAGCTATTTAACCTCGAG
CCCCCTTTGACTCACGATGCGCCAGTCCTCATAACCCGTTGGGAAGATGCTATGTAA
Transcript >OphauG2|4309
ATGGCCACTCCAGCTTCACATGCCCAGGCTAGTCTTGCTGGCGCGAGATACGGACTATCCGAGAGAGCTGCCTAT
AATTCTCTTCAAGACCAGCCATGGGATACAATTGAAAAGATGATGACCAACATTTGGTCGCCAGATAACACTAAC
GGCTTAGTGCATCTAGGTGTGGCGGAGAATACTCTCCTATATAAAGAAGTGGCCACGCATATTAACAACAGCTCA
ACAATCATCCCAGACCATCATCTAGGCTATGGAGTAGGCCCAAGAGGATCCCCACGTCTAAAAAAGGCCCTGGTG
TCGTTTTTCAACTCGGAATTCCGCGCACATGAGCCTGTATTGGAAAAGGAGATTCTCATTCTCCCTGGTGTTATG
GCTTTAATTGACGCTTTGGCGTGGTCAATCTGCAATGACGGCGAGGGTATTATTGTTCCGGTGCCTTTCTATACT
GGCTTCAAGCCGGCCACGTCTACAAGAGCGCGCGGAGTACTCGTGCCCGCGTCAATCCAGTCCGTTGGAAAATAC
CAGTGCCTGGATGATGTCTTTGACCCCGAGATTAACAGAAAAGCGTTGGAAGACGCACTTCTCCGGGCTACCCAA
AATGGCGTCAAGGTGCGCGCTGTAATGTTGACCAAGTATGAGATCCCCAAGTTGCGGAAGCTATTTAACCTCGAG
CCCCCTTTGACTCACGATGCGCCAGTCCTCATAACCCGTTGGGAAGATGCTATGTAA
Gene >OphauG2|4309
ATGGCCACTCCAGCTTCACATGCCCAGGCTAGTCTTGCTGGCGCGAGATACGGACTATCCGAGAGAGCTGCCTAT
AATTCTCTTCAAGACCAGCCATGGGATACAATTGAAAAGATGATGACCAACATTTGGTCGCCAGATAACACTAAC
GGCTTGTGAGCTTGACTCCTACACAAACCATGACTTATTCTTTTTATTTCGTGCGCCAAATGTCGTATGCTAATG
AGCCAAAAGAGTGCATCTAGGTGTGGCGGAGAATACTCTCCTATATAAAGAAGTGGCCACGCATATTAACAACAG
CGTAAGAAGAGGCGAGCGAACCAAGGTGGGCCCATTCTAACGAGACACCCAGTCAACAATCATCCCAGACCATCA
TCTAGGCTATGGAGTAGGCCCAAGAGGATCCCCACGTCTAAAAAAGGCCCTGGTGTCGTTTTTCAACTCGGAATT
CCGCGCACATGAGCCTGTATTGGAAAAGGAGATTCTCATTCTCCCTGGTGTTATGGCTTTAATTGACGCTTTGGC
GTGGTCAATCTGCAATGACGGCGAGGGTATTATTGTTCCGGTGCCTTTCTATACTGGCTTCAAGCCGGCCACGTC
TACAAGAGCGCGCGGAGTACTCGTGCCCGCGTCAATCCAGTCCGTTGGAAAATACCAGTGCCTGGATGATGTCTT
TGACCCCGAGATTAACAGAAAAGCGTTGGAAGACGCACTTCTCCGGGCTACCCAAAATGGCGTCAAGGTGCGCGC
TGTAATGTTGACCAAGTATGAGATCCCCAAGTTGCGGAAGCTATTTAACCTCGAGCCCCCTTTGACTCACGATGC
GCCAGTCCTCATAACCCGTTGGGAAGATGCTATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail