Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4307
Gene name
LocationContig_355:6373..7872
Strand-
Gene length (bp)1499
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 2.5E-27 202 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 87 417 1.0E-45
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 87 417 9.0E-45
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 87 417 3.0E-44
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 6 406 5.0E-35
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 81 393 2.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 87 417 1.0E-45
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 87 417 9.0E-45
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 87 417 3.0E-44
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 6 406 5.0E-35
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 81 393 2.0E-34
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 248 409 5.0E-24
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 105 409 2.0E-23
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 80 401 4.0E-21
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 80 405 2.0E-19
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 74 392 3.0E-19
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 87 402 9.0E-18
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 136 401 5.0E-17
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 217 396 6.0E-15
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 217 401 6.0E-15
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 149 396 8.0E-15
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 74 413 9.0E-15
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 149 396 1.0E-14
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 209 402 1.0E-14
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 83 413 1.0E-14
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 217 396 2.0E-14
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 217 399 3.0E-14
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 239 413 3.0E-14
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 239 413 4.0E-14
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 239 413 4.0E-14
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 217 396 5.0E-14
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 244 403 7.0E-14
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 149 388 8.0E-14
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 217 402 1.0E-13
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 217 396 1.0E-13
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 217 396 1.0E-13
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 208 396 1.0E-13
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 221 406 2.0E-13
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 217 400 2.0E-13
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 217 396 3.0E-13
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 217 388 3.0E-13
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 244 388 4.0E-13
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 217 396 4.0E-13
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 83 402 4.0E-13
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 217 396 4.0E-13
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 224 401 1.0E-12
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 79 403 1.0E-12
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 217 396 3.0E-12
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 217 396 3.0E-12
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 185 390 4.0E-12
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 143 392 6.0E-12
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 248 396 7.0E-12
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 248 396 7.0E-12
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 217 396 2.0E-11
sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 243 406 2.0E-11
sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 217 381 5.0E-11
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 217 396 5.0E-11
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 248 396 6.0E-11
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 80 402 7.0E-11
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 247 402 1.0E-10
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 80 401 1.0E-10
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 80 401 2.0E-10
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 244 396 2.0E-10
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 244 403 2.0E-10
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 83 401 3.0E-10
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 246 397 3.0E-10
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 244 414 3.0E-10
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 248 392 4.0E-10
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 248 396 4.0E-10
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 80 396 4.0E-10
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 217 396 1.0E-09
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 70 400 2.0E-09
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 84 401 4.0E-09
sp|P0DH60|M3OM2_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 2 OS=Pisum sativum GN=HMM2 PE=1 SV=1 83 401 4.0E-09
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 248 396 6.0E-09
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 266 396 1.0E-08
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 236 345 1.0E-08
sp|A9X7L0|ANMT_RUTGR Anthranilate N-methyltransferase OS=Ruta graveolens PE=1 SV=1 247 388 3.0E-08
sp|Q84KK4|I4OMT_LOTJA Isoflavone 4'-O-methyltransferase OS=Lotus japonicus GN=HI4'OMT PE=1 SV=1 83 401 4.0E-08
sp|Q84KK6|I4OMT_GLYEC Isoflavone 4'-O-methyltransferase OS=Glycyrrhiza echinata GN=HI4'OMT PE=1 SV=1 83 401 1.0E-07
sp|B4XY98|AZIB2_STREG 3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase OS=Streptomyces sahachiroi GN=aziB2 PE=1 SV=1 218 350 2.0E-07
sp|Q6ZD89|OMT1_ORYSJ Flavone 3'-O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=ROMT-9 PE=1 SV=1 293 397 2.0E-07
sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 169 406 2.0E-07
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 244 406 3.0E-07
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 248 396 4.0E-07
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 248 396 1.0E-06
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 244 406 1.0E-06
sp|Q84N28|FOMT1_WHEAT Flavone O-methyltransferase 1 OS=Triticum aestivum GN=OMT1 PE=1 SV=1 293 396 2.0E-06
sp|B3GSH5|ASMT_RAT Acetylserotonin O-methyltransferase OS=Rattus norvegicus GN=Asmt PE=1 SV=1 248 412 2.0E-06
sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 244 406 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4307
MASKESRSRIVQLANNILTSVSKIDEFLSEKGIESPSFNEDASFDMPLEITPDQDIVIDATAELHDLLVEPLTLI
HKHGGHNNSVCLEAISEFKIADLVPANGQISFDDIAKHTPMTSDMTARILRHAMTMRIFREAEPGMVAHTAASRV
LRHSAANDWLGAGTKEMWPAACKMVDALQKWPKSEETNETGYALSNNGLETVYDIFARDSERALRWARGMQVFGQ
RPQFNLSFVTDYYDWASLGEAQVVDVGGSQGHVSLALAEKFNNLDMIVQDMEKVVENATVPEELQGRVKFMAHDF
FAQQPVQGADVYYLRWILHNWSDKYCILILRALLPALKHGARVIINESLMPVPGAEAMWKEKSLRATDLNMAAAF
NAKERTVAEFKALFEKSDAGFVLHRVIEPKGSALGMLEFVWEGTH*
Coding >OphauG2|4307
ATGGCTTCCAAAGAGTCCCGCTCGCGAATTGTACAGCTTGCAAATAACATTCTCACGTCAGTGAGCAAGATTGAT
GAATTCCTATCGGAAAAGGGCATCGAATCGCCTAGCTTCAACGAAGATGCCTCCTTTGACATGCCCCTCGAGATA
ACCCCTGATCAAGACATTGTGATCGACGCCACTGCAGAGCTCCATGATTTGCTCGTAGAGCCTCTAACTCTTATA
CACAAGCATGGAGGTCACAATAACTCGGTATGCTTGGAAGCTATTTCCGAGTTTAAAATTGCAGATTTGGTCCCG
GCGAATGGCCAGATATCCTTTGACGATATTGCCAAGCATACTCCGATGACAAGTGATATGACGGCCCGCATTCTC
CGTCATGCCATGACTATGCGCATCTTTCGCGAGGCCGAACCAGGGATGGTGGCCCACACCGCCGCTTCTAGAGTG
CTGAGGCATTCTGCGGCGAATGACTGGCTAGGAGCTGGCACAAAGGAAATGTGGCCGGCAGCTTGCAAGATGGTC
GATGCTCTTCAAAAGTGGCCAAAGTCGGAGGAAACGAATGAGACGGGTTACGCCTTGTCGAACAATGGCTTAGAG
ACCGTCTACGACATCTTTGCCAGAGATTCCGAGCGGGCTTTGCGCTGGGCAAGGGGGATGCAGGTCTTCGGCCAA
AGACCCCAATTCAATTTGTCCTTTGTCACCGATTACTACGACTGGGCCTCTTTGGGTGAGGCTCAAGTCGTCGAC
GTCGGGGGGTCCCAAGGACATGTTTCCCTAGCCCTAGCGGAAAAGTTTAACAACCTTGACATGATTGTCCAGGAC
ATGGAGAAAGTGGTTGAGAACGCCACGGTTCCAGAAGAATTGCAGGGGAGAGTGAAATTCATGGCTCACGATTTC
TTTGCCCAGCAGCCTGTTCAGGGAGCAGACGTCTACTACTTGCGCTGGATCCTGCACAACTGGTCCGATAAGTAC
TGCATCTTGATCTTGCGTGCGTTGCTTCCGGCGCTCAAGCACGGAGCAAGGGTCATAATCAATGAGTCCTTGATG
CCAGTTCCCGGCGCAGAGGCCATGTGGAAGGAGAAGAGCCTAAGGGCTACTGATTTGAACATGGCTGCCGCTTTT
AATGCAAAGGAGAGAACAGTTGCCGAGTTCAAAGCGTTGTTCGAAAAGAGTGACGCGGGATTTGTGCTTCACAGG
GTTATTGAGCCGAAAGGGTCAGCTCTTGGCATGTTGGAATTCGTGTGGGAGGGCACGCATTAG
Transcript >OphauG2|4307
ATGGCTTCCAAAGAGTCCCGCTCGCGAATTGTACAGCTTGCAAATAACATTCTCACGTCAGTGAGCAAGATTGAT
GAATTCCTATCGGAAAAGGGCATCGAATCGCCTAGCTTCAACGAAGATGCCTCCTTTGACATGCCCCTCGAGATA
ACCCCTGATCAAGACATTGTGATCGACGCCACTGCAGAGCTCCATGATTTGCTCGTAGAGCCTCTAACTCTTATA
CACAAGCATGGAGGTCACAATAACTCGGTATGCTTGGAAGCTATTTCCGAGTTTAAAATTGCAGATTTGGTCCCG
GCGAATGGCCAGATATCCTTTGACGATATTGCCAAGCATACTCCGATGACAAGTGATATGACGGCCCGCATTCTC
CGTCATGCCATGACTATGCGCATCTTTCGCGAGGCCGAACCAGGGATGGTGGCCCACACCGCCGCTTCTAGAGTG
CTGAGGCATTCTGCGGCGAATGACTGGCTAGGAGCTGGCACAAAGGAAATGTGGCCGGCAGCTTGCAAGATGGTC
GATGCTCTTCAAAAGTGGCCAAAGTCGGAGGAAACGAATGAGACGGGTTACGCCTTGTCGAACAATGGCTTAGAG
ACCGTCTACGACATCTTTGCCAGAGATTCCGAGCGGGCTTTGCGCTGGGCAAGGGGGATGCAGGTCTTCGGCCAA
AGACCCCAATTCAATTTGTCCTTTGTCACCGATTACTACGACTGGGCCTCTTTGGGTGAGGCTCAAGTCGTCGAC
GTCGGGGGGTCCCAAGGACATGTTTCCCTAGCCCTAGCGGAAAAGTTTAACAACCTTGACATGATTGTCCAGGAC
ATGGAGAAAGTGGTTGAGAACGCCACGGTTCCAGAAGAATTGCAGGGGAGAGTGAAATTCATGGCTCACGATTTC
TTTGCCCAGCAGCCTGTTCAGGGAGCAGACGTCTACTACTTGCGCTGGATCCTGCACAACTGGTCCGATAAGTAC
TGCATCTTGATCTTGCGTGCGTTGCTTCCGGCGCTCAAGCACGGAGCAAGGGTCATAATCAATGAGTCCTTGATG
CCAGTTCCCGGCGCAGAGGCCATGTGGAAGGAGAAGAGCCTAAGGGCTACTGATTTGAACATGGCTGCCGCTTTT
AATGCAAAGGAGAGAACAGTTGCCGAGTTCAAAGCGTTGTTCGAAAAGAGTGACGCGGGATTTGTGCTTCACAGG
GTTATTGAGCCGAAAGGGTCAGCTCTTGGCATGTTGGAATTCGTGTGGGAGGGCACGCATTAG
Gene >OphauG2|4307
ATGGCTTCCAAAGAGTCCCGCTCGCGAATTGTACAGCTTGCAAATAACATTCTCACGTCAGTGAGCAAGATTGAT
GAATTCCTATCGGAAAAGGGCATCGAATCGCCTAGCTTCAACGAAGATGCCTCCTTTGACATGCCCCTCGAGATA
ACCCCTGATCAAGACATTGTGATCGACGCCACTGCAGAGCTCCATGATTTGCTCGTAGAGCCTCTAACTCTTATA
CACAAGCATGGAGGTGTAAGTATATTTTTCTCAATACGATTACAAGGGTACAAGGGCTGATTGTATTGGCCTGCA
AAGCACAATAACTCGGTATGCTTGGAAGCTATTTCCGAGTTTAAAATTGCAGATTTGGTCCCGGCGAATGGCCAG
ATATCCTTTGACGATATTGCCAAGCATACTCCGATGACAAGTGATATGACGGCCCGCATTCTCCGTCATGCCATG
ACTATGCGCATCTTTCGCGAGGCCGAACCAGGGATGGTGGCCCACACCGCCGCTTCTAGAGTGCTGAGGCATTCT
GCGGCGAATGACTGGCTAGGAGCTGGCACAAAGGAAATGTGGCCGGCAGCTTGCAAGGTTAGTGCTTAGTTAATT
CCATCCCCCTCATCTCATCTACGCAGCTCATTGGTTCGTATCTAGATGGTCGATGCTCTTCAAAAGTGGCCAAAG
TCGGAGGAAACGAATGAGACGGTAAGATTGCCTATATTTTTCGAGTATTGATACAAGCAACTCAGTACTTTTCGG
TAGGGTTACGCCTTGTCGAACAATGGCTTAGAGACCGTCTACGACATCTTTGCCAGAGATTCCGAGCGGGCTTTG
CGCTGGGCAAGGGGGATGCAGGTCTTCGGCCAAAGACCCCAATTCAATTTGTCCTTTGTCACCGATTACTACGAC
TGGGCCTCTTTGGGTGAGGCTCAAGTCGTCGACGTCGGGGGGTCCCAAGGACATGTTTCCCTAGCCCTAGCGGAA
AAGTTTAACAACCTTGACATGATTGTCCAGGACATGGAGAAAGTGGTTGAGAACGCCACGGTTCCAGAAGAATTG
CAGGGGAGAGTGAAATTCATGGCTCACGATTTCTTTGCCCAGCAGCCTGTTCAGGGAGCAGACGTCTACTACTTG
CGCTGGATCCTGCACAACTGGTCCGATAAGTACTGCATCTTGATCTTGCGTGCGTTGCTTCCGGCGCTCAAGCAC
GGAGCAAGGGTCATAATCAATGAGTCCTTGATGCCAGTTCCCGGCGCAGAGGCCATGTGGAAGGAGAAGAGCCTA
AGGTCCGTGCAAGATGTTGAGAGCATTGATGGGAAATTCGGCTGAATGGTAGTAGGGCTACTGATTTGAACATGG
CTGCCGCTTTTAATGCAAAGGAGAGAACAGTTGCCGAGTTCAAAGCGTTGTTCGAAAAGAGTGACGCGGGATTTG
TGCTTCACAGGGTTATTGAGCCGAAAGGGTCAGCTCTTGGCATGTTGGAATTCGTGTGGGAGGGCACGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail