Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4305
Gene name
LocationContig_355:2067..3756
Strand-
Gene length (bp)1689
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.0E-21 339 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 70 526 2.0E-29
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 70 526 6.0E-29
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 112 500 2.0E-24
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 112 525 4.0E-24
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 112 526 8.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q701P2|KO1_GIBIN Ent-kaurene oxidase OS=Gibberella intermedia GN=CYP503A1 PE=1 SV=1 70 526 2.0E-29
sp|O94142|KO1_GIBFU Ent-kaurene oxidase OS=Gibberella fujikuroi GN=CYP503A1 PE=1 SV=1 70 526 6.0E-29
sp|Q4WAX0|FTMG_ASPFU Fumitremorgin C monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-3 PE=3 SV=1 112 500 2.0E-24
sp|B9WZX6|FTMG_ASPFM Fumitremorgin C monooxygenase OS=Neosartorya fumigata GN=ftmP450-3 PE=1 SV=1 112 525 4.0E-24
sp|A1DA65|FTMG_NEOFI Fumitremorgin C monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-3 PE=3 SV=1 112 526 8.0E-23
sp|Q9Y7C8|LOVA_ASPTE Dihydromonacolin L monooxygenase LovA OS=Aspergillus terreus GN=lovA PE=1 SV=1 121 500 7.0E-21
sp|Q9VMT5|C28D1_DROME Probable cytochrome P450 28d1 OS=Drosophila melanogaster GN=Cyp28d1 PE=2 SV=1 216 506 9.0E-12
sp|O46491|CP7A1_PIG Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 364 526 4.0E-11
sp|A2Z212|ABAH3_ORYSI Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 252 501 2.0E-10
sp|Q0J185|ABAH3_ORYSJ Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 252 501 2.0E-10
sp|Q60991|CP7B1_MOUSE 25-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp7b1 PE=2 SV=2 360 500 5.0E-10
sp|O02766|CP8B1_RABIT 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Oryctolagus cuniculus GN=CYP8B1 PE=1 SV=3 339 526 2.0E-09
sp|Q9VMT6|C28D2_DROME Probable cytochrome P450 28d2 OS=Drosophila melanogaster GN=Cyp28d2 PE=3 SV=1 283 505 4.0E-09
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 249 509 4.0E-09
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 161 522 7.0E-09
sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 344 514 8.0E-09
sp|Q63688|CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus GN=Cyp7b1 PE=1 SV=1 250 526 1.0E-08
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 360 526 2.0E-08
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 361 526 3.0E-08
sp|Q9C5Y2|KAO2_ARATH Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 340 502 3.0E-08
sp|P51542|CP7A1_RABIT Cholesterol 7-alpha-monooxygenase OS=Oryctolagus cuniculus GN=CYP7A1 PE=1 SV=1 370 518 6.0E-08
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 284 498 7.0E-08
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 357 502 8.0E-08
sp|P18125|CP7A1_RAT Cholesterol 7-alpha-monooxygenase OS=Rattus norvegicus GN=Cyp7a1 PE=1 SV=1 364 526 1.0E-07
sp|P46634|CP7A1_CRIGR Cholesterol 7-alpha-monooxygenase OS=Cricetulus griseus GN=CYP7A1 PE=3 SV=1 364 526 1.0E-07
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 224 499 2.0E-07
sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 340 502 2.0E-07
sp|Q09J78|ABAH2_ORYSI Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. indica GN=CYP707A6 PE=2 SV=1 300 501 2.0E-07
sp|Q6ZDE3|ABAH2_ORYSJ Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. japonica GN=CYP707A6 PE=2 SV=1 300 501 2.0E-07
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 284 498 3.0E-07
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 234 497 4.0E-07
sp|Q7YRB2|CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa GN=CYP8B1 PE=2 SV=1 350 499 5.0E-07
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 340 501 6.0E-07
sp|Q9UNU6|CP8B1_HUMAN 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Homo sapiens GN=CYP8B1 PE=1 SV=2 339 524 6.0E-07
sp|O64718|C71B9_ARATH Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3 224 499 6.0E-07
sp|Q9V979|CP6U1_DROME Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3 323 492 9.0E-07
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 325 495 1.0E-06
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 266 525 2.0E-06
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 370 495 2.0E-06
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 223 501 3.0E-06
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 270 509 3.0E-06
sp|Q9VQD2|CP391_DROME Probable cytochrome P450 309a1 OS=Drosophila melanogaster GN=Cyp309a1 PE=1 SV=4 337 498 3.0E-06
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 220 521 4.0E-06
sp|Q9V776|CP317_DROME Probable cytochrome P450 317a1 OS=Drosophila melanogaster GN=Cyp317a1 PE=3 SV=2 206 512 4.0E-06
sp|Q9V769|C6A22_DROME Cytochrome P450 6a22 OS=Drosophila melanogaster GN=Cyp6a22 PE=2 SV=1 225 507 6.0E-06
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 196 499 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0004497 monooxygenase activity Yes
GO:0005506 iron ion binding Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0046906 tetrapyrrole binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4305
MMPLLQSLVYLAIASFVFVFCQLLRLKFSSRPAVWAKLDAVGPSPQECPPSFARDVALSVVRMQRFANDGYRRFS
KALDRPFALPTTWVRGGTVMVLPPSKIALLARPDKTNDGEWTNVHGLIETTQLAHVMDDASVYQNLLHFEVVRRN
MGPRDMSRLAPVTADEIEDSFLRIWGIETQWRALNGWEACGRIISRASQRILIGLPLSRDEAMLETSRVYANSLL
VGGAIMNCFPPSMRWLVAPLIAARARYLQARYVRMLLPLVQERIRQWEEGKGTDGGPDDFLQWMLPTCANEPGQL
DANRIALRLASLLTPLIFATCYVFAHCVLDIHGSPSRAEILAGLEEECRRVRDQHGGLATRESVDALKRVDSVLR
ESMRVSDVMVTNIFRDVTAGEVDLGNGLRVGPGVRMVFPTQDIHLDPDNYQDPGRFDAFRFSRPFEDSNGSSGRQ
EGEQQLVTTATPTFMPFGYGRHVCPGRWFVAQAMKQALAHLVLNYDVELVGPRIKRKALLNMMVPPVDAKIRIRR
KM*
Coding >OphauG2|4305
ATGATGCCCTTGTTGCAGAGCCTTGTCTACTTGGCCATAGCCAGCTTCGTCTTCGTCTTTTGTCAATTGCTCCGC
CTCAAGTTTTCGTCGCGGCCAGCAGTATGGGCCAAGCTGGACGCCGTCGGCCCTTCACCACAGGAGTGTCCGCCG
TCGTTTGCTCGTGATGTCGCATTGTCGGTTGTGCGCATGCAAAGGTTCGCCAATGATGGCTATCGCAGGTTCAGC
AAGGCCTTGGACCGGCCATTCGCCCTTCCCACAACTTGGGTGCGCGGAGGCACCGTCATGGTGCTGCCGCCGTCC
AAGATTGCCCTTCTGGCGCGTCCGGACAAGACCAACGATGGCGAGTGGACAAATGTGCATGGGCTCATTGAAACC
ACCCAGCTAGCCCATGTAATGGACGATGCCAGCGTCTACCAAAATCTGCTGCACTTTGAAGTTGTACGCCGCAAC
ATGGGCCCTCGGGATATGAGCCGCCTGGCACCAGTGACGGCAGACGAGATTGAAGACTCCTTTCTCCGTATATGG
GGGATCGAAACACAGTGGAGAGCACTCAATGGCTGGGAGGCGTGTGGCCGAATCATCTCTCGCGCCTCACAGCGT
ATCCTCATCGGCCTGCCCCTGAGCCGCGACGAGGCAATGCTGGAAACATCACGGGTCTATGCAAATTCTCTCCTC
GTCGGGGGCGCCATTATGAATTGCTTTCCCCCGTCCATGCGGTGGCTCGTGGCGCCTCTGATTGCTGCGCGTGCT
CGATACTTGCAGGCGCGTTATGTGAGGATGCTGCTGCCTTTGGTCCAAGAGCGCATCCGTCAATGGGAAGAGGGC
AAAGGCACGGATGGTGGTCCAGACGACTTTCTTCAATGGATGCTTCCGACATGTGCCAACGAGCCTGGCCAGCTC
GATGCCAACCGCATTGCCCTGCGCTTGGCCAGCCTCCTAACTCCTCTCATCTTTGCCACCTGCTACGTCTTTGCA
CACTGCGTTCTTGATATACACGGCAGCCCGTCCCGTGCGGAAATCCTGGCGGGCCTCGAGGAGGAGTGCAGGCGT
GTGCGAGACCAGCACGGGGGTCTCGCCACCCGCGAGTCCGTCGATGCCCTGAAGCGCGTCGATTCCGTCTTGAGA
GAGTCGATGCGCGTCTCAGACGTCATGGTGACAAACATCTTCCGCGACGTCACCGCCGGCGAGGTAGACTTGGGC
AACGGACTGCGCGTGGGCCCTGGCGTGCGCATGGTGTTTCCAACTCAGGACATTCACCTGGATCCAGACAACTAT
CAAGATCCGGGGCGGTTTGATGCATTCCGCTTCTCCAGGCCTTTTGAGGATTCAAATGGTAGCAGTGGTCGCCAA
GAGGGAGAGCAGCAGCTGGTTACCACAGCGACGCCAACATTTATGCCCTTTGGCTACGGGAGGCATGTTTGTCCT
GGCAGGTGGTTTGTGGCGCAGGCCATGAAACAGGCGCTGGCACATCTTGTGCTCAACTACGACGTCGAGTTGGTG
GGGCCACGGATCAAGAGAAAGGCTCTTCTTAATATGATGGTGCCTCCTGTGGATGCCAAAATCAGAATAAGACGA
AAGATGTGA
Transcript >OphauG2|4305
ATGATGCCCTTGTTGCAGAGCCTTGTCTACTTGGCCATAGCCAGCTTCGTCTTCGTCTTTTGTCAATTGCTCCGC
CTCAAGTTTTCGTCGCGGCCAGCAGTATGGGCCAAGCTGGACGCCGTCGGCCCTTCACCACAGGAGTGTCCGCCG
TCGTTTGCTCGTGATGTCGCATTGTCGGTTGTGCGCATGCAAAGGTTCGCCAATGATGGCTATCGCAGGTTCAGC
AAGGCCTTGGACCGGCCATTCGCCCTTCCCACAACTTGGGTGCGCGGAGGCACCGTCATGGTGCTGCCGCCGTCC
AAGATTGCCCTTCTGGCGCGTCCGGACAAGACCAACGATGGCGAGTGGACAAATGTGCATGGGCTCATTGAAACC
ACCCAGCTAGCCCATGTAATGGACGATGCCAGCGTCTACCAAAATCTGCTGCACTTTGAAGTTGTACGCCGCAAC
ATGGGCCCTCGGGATATGAGCCGCCTGGCACCAGTGACGGCAGACGAGATTGAAGACTCCTTTCTCCGTATATGG
GGGATCGAAACACAGTGGAGAGCACTCAATGGCTGGGAGGCGTGTGGCCGAATCATCTCTCGCGCCTCACAGCGT
ATCCTCATCGGCCTGCCCCTGAGCCGCGACGAGGCAATGCTGGAAACATCACGGGTCTATGCAAATTCTCTCCTC
GTCGGGGGCGCCATTATGAATTGCTTTCCCCCGTCCATGCGGTGGCTCGTGGCGCCTCTGATTGCTGCGCGTGCT
CGATACTTGCAGGCGCGTTATGTGAGGATGCTGCTGCCTTTGGTCCAAGAGCGCATCCGTCAATGGGAAGAGGGC
AAAGGCACGGATGGTGGTCCAGACGACTTTCTTCAATGGATGCTTCCGACATGTGCCAACGAGCCTGGCCAGCTC
GATGCCAACCGCATTGCCCTGCGCTTGGCCAGCCTCCTAACTCCTCTCATCTTTGCCACCTGCTACGTCTTTGCA
CACTGCGTTCTTGATATACACGGCAGCCCGTCCCGTGCGGAAATCCTGGCGGGCCTCGAGGAGGAGTGCAGGCGT
GTGCGAGACCAGCACGGGGGTCTCGCCACCCGCGAGTCCGTCGATGCCCTGAAGCGCGTCGATTCCGTCTTGAGA
GAGTCGATGCGCGTCTCAGACGTCATGGTGACAAACATCTTCCGCGACGTCACCGCCGGCGAGGTAGACTTGGGC
AACGGACTGCGCGTGGGCCCTGGCGTGCGCATGGTGTTTCCAACTCAGGACATTCACCTGGATCCAGACAACTAT
CAAGATCCGGGGCGGTTTGATGCATTCCGCTTCTCCAGGCCTTTTGAGGATTCAAATGGTAGCAGTGGTCGCCAA
GAGGGAGAGCAGCAGCTGGTTACCACAGCGACGCCAACATTTATGCCCTTTGGCTACGGGAGGCATGTTTGTCCT
GGCAGGTGGTTTGTGGCGCAGGCCATGAAACAGGCGCTGGCACATCTTGTGCTCAACTACGACGTCGAGTTGGTG
GGGCCACGGATCAAGAGAAAGGCTCTTCTTAATATGATGGTGCCTCCTGTGGATGCCAAAATCAGAATAAGACGA
AAGATGTGA
Gene >OphauG2|4305
ATGATGCCCTTGTTGCAGAGCCTTGTCTACTTGGCCATAGCCAGCTTCGTCTTCGTCTTTTGTCAATTGCTCCGC
CTCAAGTTTTCGTCGCGGCCAGCAGTATGGGCCAAGCTGGACGCCGTCGGCCCTTCACCACAGGAGTGTCCGCCG
TCGTTTGCTCGTGATGTCGCATTGTCGGTTGTGCGCATGCAAAGGTTCGCCAATGATGGCTATCGCAGGTTCAGC
AAGGCCTTGGACCGGCCATTCGCCCTTCCCACAACTTGGGTGCGCGGAGGCACCGTCATGGTGCTGCCGCCGTCC
AAGATTGCCCTTCTGGCGCGTCCGGACAAGACCAACGATGGCGAGTGGACAAATGTGCATGGGCTCATTGAAACC
ACCCAGCTAGCCCATGTAATGGACGATGCCAGCGTCTACCAAAATCTGCTGCACTTTGAAGTTGTACGCCGCAAC
ATGGGCCCTCGGGATATGAGCCGCCTGGCACCAGTGACGGCAGACGAGATTGAAGACTCCTTTCTCCGTATATGG
GGGATCGAAACACAGTGGAGAGCACTCAATGGCTGGGAGGCGTGTGGCCGAATCATCTCTCGCGCCTCACAGCGT
ATCCTCATCGGCCTGCCCCTGAGCCGCGACGAGGCAATGCTGGAAACATCACGGGTCTATGCAAATTCTCTCCTC
GTCGGGGGCGCCATTATGAATTGCTTTCCCCCGTCCATGCGGTGGCTCGTGGCGCCTCTGATTGCTGCGCGTGCT
CGATACTTGCAGGCGCGTTATGTGAGGATGCTGCTGCCTTTGGTCCAAGAGCGCATCCGTCAATGGGAAGAGGGC
AAAGGCACGGATGGTGGTCCAGTACGTCCTCACCATGGCAAACTTTCCTGTTGCTCTCCCCTGTTGCTCTCCCCT
GTTGCTCTCCCTTATTGTCCACCCTACTAACATGCCTCTCTCTTCCATCAGGACGACTTTCTTCAATGGATGCTT
CCGACATGTGCCAACGAGCCTGGCCAGCTCGATGCCAACCGCATTGCCCTGCGCTTGGCCAGCCTCCTAACTCCT
CTCATCTTTGCCACCTGCTACGTCTTTGCACACTGCGTTCTTGATATACACGGCAGCCCGTCCCGTGCGGAAATC
CTGGCGGGCCTCGAGGAGGAGTGCAGGCGTGTGCGAGACCAGCACGGGGGTCTCGCCACCCGCGAGTCCGTCGAT
GCCCTGAAGCGCGTCGATTCCGTCTTGAGAGAGTCGATGCGCGTCTCAGACGTCATGGTGACAAACATCTTCCGC
GACGTCACCGCCGGCGAGGTAGACTTGGGCAACGGACTGCGCGTGGGCCCTGGCGTGCGCATGGTGTTTCCAACT
CAGGACATTCACCTGGATCCAGACAACTATCAAGATCCGGGGCGGTTTGATGCATTCCGCTTCTCCAGGCCTTTT
GAGGATTCAAATGGTAGCAGTGGTCGCCAAGAGGGAGAGCAGCAGCTGGTTACCACAGCGACGCCAACATTTATG
CCCTTTGGCTACGGGAGGCATGTTTGTCCTGGCAGGTGGTTTGTGGCGCAGGCCATGAAACAGGCGCTGGCACAT
CTTGTGCTCAACTACGACGTCGAGTTGGTGGGGCCACGGATCAAGAGAAAGGCTCTTCTTAATATGATGGTGCCT
CCTGTGGATGCCAAAATCAGAATAAGACGAAAGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail