Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4301
Gene name
LocationContig_354:11105..14501
Strand-
Gene length (bp)3396
Transcript length (bp)3300
Coding sequence length (bp)3300
Protein length (aa) 1100

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 7.8E-12 336 449
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 5.7E-65 606 907
PF04433 SWIRM SWIRM domain 5.4E-13 225 304
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.6E-06 331 390
PF09011 HMG_box_2 HMG-box domain 4.7E-06 967 1040

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 253 912 8.0E-84
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 222 912 5.0E-80
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 222 912 6.0E-80
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 580 909 3.0E-56
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 582 909 1.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 253 912 8.0E-84
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 222 912 5.0E-80
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 222 912 6.0E-80
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 580 909 3.0E-56
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 582 909 1.0E-55
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 585 907 2.0E-55
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 602 909 2.0E-55
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 604 906 3.0E-54
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 606 907 3.0E-54
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 604 906 1.0E-53
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 603 910 2.0E-49
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 608 905 3.0E-35
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 577 906 1.0E-33
sp|Q10135|LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd2 PE=1 SV=1 221 382 2.0E-32
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 597 906 2.0E-32
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 591 905 4.0E-32
sp|Q9Y802|LSD1_SCHPO Lysine-specific histone demethylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd1 PE=1 SV=1 203 478 2.0E-30
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 608 903 5.0E-30
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 669 932 6.0E-29
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 644 919 9.0E-25
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 644 907 9.0E-25
sp|Q9Y802|LSD1_SCHPO Lysine-specific histone demethylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd1 PE=1 SV=1 585 1062 3.0E-24
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 644 919 1.0E-23
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 252 486 1.0E-23
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 674 907 2.0E-23
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 251 471 8.0E-22
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 604 910 3.0E-20
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 620 908 6.0E-20
sp|Q10135|LSD2_SCHPO Lysine-specific histone demethylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd2 PE=1 SV=1 652 1060 1.0E-19
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 688 908 1.0E-19
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 251 471 5.0E-19
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 654 912 9.0E-19
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 689 908 4.0E-18
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 253 493 4.0E-17
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 251 471 1.0E-16
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 251 471 1.0E-16
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 253 474 1.0E-15
sp|P50264|FMS1_YEAST Polyamine oxidase FMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMS1 PE=1 SV=1 652 906 2.0E-15
sp|P31225|CBP1_CANAL Corticosteroid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP1 PE=1 SV=2 643 910 1.0E-13
sp|P18487|A37C_DROME Protein anon-37Cs OS=Drosophila melanogaster GN=anon-37Cs PE=2 SV=3 691 908 3.0E-12
sp|O96566|A37C_DROSI Protein anon-37Cs (Fragment) OS=Drosophila simulans GN=anon-37Cs PE=3 SV=1 649 908 3.0E-12
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 688 910 9.0E-11
sp|Q4F867|OXLA_DABSI L-amino-acid oxidase (Fragments) OS=Daboia siamensis PE=1 SV=2 653 909 1.0E-09
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 688 910 1.0E-09
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 693 928 2.0E-09
sp|P56742|OXLA_CROAT L-amino-acid oxidase OS=Crotalus atrox PE=1 SV=2 653 913 2.0E-09
sp|F8S0Z5|OXLA2_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 653 913 2.0E-09
sp|J7H670|OXLA_LACMT L-amino acid oxidase Lm29 OS=Lachesis muta PE=1 SV=1 653 913 3.0E-09
sp|Q7YRB7|AOFB_CANLF Amine oxidase [flavin-containing] B OS=Canis lupus familiaris GN=MAOB PE=2 SV=3 688 910 3.0E-09
sp|Q6PLK3|AOFB_PIG Amine oxidase [flavin-containing] B OS=Sus scrofa GN=MAOB PE=2 SV=3 688 910 3.0E-09
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 653 909 4.0E-09
sp|G8XQX1|OXLA_DABRR L-amino-acid oxidase OS=Daboia russelii PE=1 SV=1 701 906 5.0E-09
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 693 913 6.0E-09
sp|K9N7B7|OXLA_CRODM L-amino acid oxidase Cdc18 (Fragment) OS=Crotalus durissus cumanensis PE=1 SV=1 653 913 8.0E-09
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 688 910 1.0E-08
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 688 910 1.0E-08
sp|B0VXW0|OXLA_SISCA L-amino-acid oxidase OS=Sistrurus catenatus edwardsii PE=2 SV=1 653 913 1.0E-08
sp|B5U6Y8|OXLA_ECHOC L-amino-acid oxidase OS=Echis ocellatus PE=1 SV=1 699 909 2.0E-08
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 653 928 2.0E-08
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 693 913 2.0E-08
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 642 928 3.0E-08
sp|O93364|OXLA_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 653 913 3.0E-08
sp|Q21988|AMX1_CAEEL Amine oxidase family member 1 OS=Caenorhabditis elegans GN=amx-1 PE=3 SV=3 253 467 4.0E-08
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 700 910 4.0E-08
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 693 906 6.0E-08
sp|X2L4E2|OXLA_BOTPC L-amino acid oxidase (Fragment) OS=Bothrops pictus PE=2 SV=1 675 906 3.0E-07
sp|Q96RQ9|OXLA_HUMAN L-amino-acid oxidase OS=Homo sapiens GN=IL4I1 PE=1 SV=1 693 906 4.0E-07
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 693 906 4.0E-07
sp|P81382|OXLA_CALRH L-amino-acid oxidase OS=Calloselasma rhodostoma PE=1 SV=2 698 913 4.0E-07
sp|P9WQ15|AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aofH PE=1 SV=1 674 906 5.0E-07
sp|P9WQ14|AOFH_MYCTO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aofH PE=3 SV=1 674 906 5.0E-07
sp|P63534|AOFH_MYCBO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aofH PE=3 SV=1 674 906 5.0E-07
sp|A0A024BTN9|OXLA_BOTSC L-amino acid oxidase Bs29 (Fragment) OS=Bothriechis schlegelii PE=1 SV=1 653 913 5.0E-07
sp|B5AR80|OXLA_BOTPA L-amino-acid oxidase (Fragment) OS=Bothrops pauloensis PE=1 SV=1 693 906 1.0E-06
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 326 467 2.0E-06
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 309 442 3.0E-06
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 251 471 4.0E-06
sp|Q6TGQ9|OXLA_BOTJR L-amino-acid oxidase (Fragment) OS=Bothrops jararacussu PE=1 SV=1 675 909 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4722
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4301 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6346
Ophiocordyceps camponoti-floridani Ophcf2|00442
Ophiocordyceps camponoti-rufipedis Ophun1|3447
Ophiocordyceps kimflemingae Ophio5|4733
Ophiocordyceps subramaniannii Hirsu2|9946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4301
MSMTIGPDVDMDTTVGSRYLATDALFSAALSEVEDLDSLSSPPAAESIHVTHPQPGGVSLLPLASSPCLEHSAAS
SGEASKQPSEAAPEIVVRAVESRPHHGSRGEADDFSPMDVDFDDASPEDGDVELLDVVDKTAIGSFASSLSAMTE
VSETSSLSSADSSKATTPAAAELGHRDMQTDQAVKPPLYRHSIERLNFVVRPKSSIPANIPSYQYAGECIEAAES
SRLNPYALHPEEYNLLRHHISYTQVTTYLNIRNSILRIWMRHPWTAVSRHDAIGCTNARWFDAASVCYDWLVRRG
YINFGCVKSLPEASAMEPIAPQAKKQRTVVVVGAGISGLACARQLEGLFKQYADYYRDIGEVPPRVIIVEGRSRV
GGRVYSREFKSRPIGQDQSELPAKRHTAEMGGMIITGFDRGNPMNVIVRAQLGLPYHVLRADTTIYDSNGKPVDS
VRDELVEKLYNDCLDRVSEFKLKAQPSKLIEGNRDLINDARDSPSDGTKSIAQAEEAAAALPHAPPVSQLNVSDK
VDMIPVSSDKLTGRVHNVPGVPAILKAGEKAKLMGWNLRSGVNGDQDIQLGDAAHGQGATLGSVLDHAIAQYKTF
VDLTAQDHRLINWHVANLEYSNAANLHSLSLGLWDIDAGNEWEGHHTMVDGGYQSVARGLLQCPSTLNLTTRFAV
KQITYQGHGSSGSALVEAEDGTTIEADFVVCTVPLGVLKQGTVVFDPPLPPCKTGVIERLGFGILNKVVLVYQEV
FWEAERHIFGVLRDAANRHSTAQKDYASSRGRFFQWFNVTSSTGLPCLIALMAGDAGHETEHCSNNHLISEATGI
LRAVFGRDIPYPVEAVVTRWGSDRFARGSYSSAGPDMLPDDYDSMARPLGNLFFAGEHTIGTHPATVHGAYLSGL
RAASEVLEAMVGPIQVPTPLILTKDSLLLHKRKEAAKDPKQARLEAYEMEVWDHVRSQIGERPARPSKVSGNAYL
LYSKANFDEARRRCEQNRKPGRVRSAPNEVRVMTSRMWRDATVQERKPFEEQATQQKKAYANAMQIFNQTSQAWD
QKAATLRKAYEQEHPFMSGPDESSQDHGYTSHKHRRAKHVSYAENGRMS*
Coding >OphauG2|4301
ATGTCCATGACAATTGGCCCTGATGTCGACATGGACACGACAGTCGGAAGCCGCTATCTGGCCACCGACGCACTC
TTTAGCGCCGCCCTGAGTGAAGTTGAGGATTTGGATTCGCTGTCGTCGCCCCCGGCGGCTGAATCTATACACGTT
ACTCATCCACAACCGGGCGGCGTGTCGTTACTGCCTCTTGCGAGTTCACCATGCCTCGAGCACTCAGCCGCCTCT
TCAGGGGAAGCGTCAAAGCAGCCCTCGGAAGCTGCTCCGGAGATTGTGGTCAGGGCAGTTGAAAGCCGCCCTCAT
CATGGCAGCCGTGGCGAGGCCGACGATTTTTCACCCATGGACGTCGATTTTGACGACGCCTCTCCTGAAGACGGT
GACGTTGAACTCTTGGATGTCGTCGACAAGACTGCAATCGGCTCTTTTGCATCATCCTTGTCAGCCATGACTGAG
GTATCGGAGACATCATCATTATCATCGGCAGACTCGAGCAAAGCTACTACCCCTGCTGCTGCAGAGCTGGGGCAT
AGGGACATGCAGACGGACCAAGCTGTCAAGCCGCCTCTATATCGGCACAGCATTGAGCGGCTCAACTTTGTTGTC
CGGCCCAAATCATCTATCCCTGCAAATATTCCATCGTATCAATATGCCGGTGAGTGCATTGAAGCAGCCGAGTCG
TCCCGTTTGAATCCCTATGCCCTACATCCTGAAGAATACAATTTGTTGCGCCACCACATCTCATACACCCAAGTC
ACGACCTATCTCAACATTCGAAATAGTATCCTGCGTATCTGGATGCGGCATCCCTGGACCGCCGTTAGCCGGCAT
GATGCTATTGGCTGCACAAACGCACGCTGGTTTGATGCTGCCAGTGTATGCTATGATTGGCTGGTCCGCCGCGGC
TACATCAACTTTGGCTGTGTCAAATCTCTTCCAGAAGCCAGCGCGATGGAGCCCATTGCGCCGCAGGCAAAGAAG
CAAAGGACGGTAGTGGTTGTTGGCGCTGGCATCTCTGGCCTGGCCTGCGCGCGGCAGTTGGAAGGGTTGTTCAAA
CAGTACGCCGATTACTACCGCGATATTGGCGAGGTACCGCCCAGGGTAATAATTGTCGAGGGGAGGAGTCGTGTA
GGAGGCAGAGTGTACTCTCGCGAATTCAAGTCGAGGCCGATTGGTCAAGATCAGTCCGAGTTGCCTGCTAAGAGA
CATACTGCCGAGATGGGCGGCATGATTATCACCGGCTTCGACCGCGGCAATCCCATGAACGTCATTGTTCGTGCC
CAGCTGGGCCTACCCTATCATGTCTTGCGAGCAGACACTACCATATATGACAGCAACGGCAAGCCGGTAGACTCT
GTCCGGGACGAGCTGGTGGAAAAACTCTACAACGACTGTCTGGATCGTGTCAGCGAGTTCAAGCTCAAGGCGCAG
CCTTCCAAGCTGATTGAGGGCAACCGAGATCTCATCAACGACGCCCGCGACAGCCCCAGTGACGGCACCAAGTCG
ATTGCTCAGGCAGAAGAGGCGGCAGCAGCTCTTCCCCATGCCCCTCCAGTGTCGCAGCTCAATGTGTCTGACAAG
GTTGATATGATACCTGTATCTTCGGATAAATTGACGGGTCGCGTACACAATGTGCCTGGTGTGCCGGCCATCTTG
AAGGCTGGGGAAAAGGCCAAGCTCATGGGCTGGAATCTGAGAAGTGGCGTCAATGGCGATCAAGACATTCAACTC
GGCGATGCGGCTCATGGCCAAGGCGCAACGCTGGGATCCGTGCTGGACCATGCCATTGCCCAGTACAAGACATTT
GTGGACTTGACGGCTCAGGACCACCGCCTCATCAACTGGCACGTTGCCAATCTGGAGTACAGCAACGCAGCCAAC
CTGCACAGCCTCAGTCTTGGCTTGTGGGACATTGACGCAGGCAACGAGTGGGAGGGCCATCACACCATGGTGGAT
GGTGGCTACCAAAGCGTTGCGCGAGGTTTACTCCAGTGCCCCAGTACCTTGAACCTGACAACCAGGTTTGCTGTG
AAGCAAATCACGTACCAAGGCCATGGCTCCTCGGGTTCCGCCCTTGTTGAGGCCGAGGATGGTACGACGATAGAG
GCCGATTTTGTAGTCTGCACCGTACCATTGGGGGTTCTGAAGCAGGGCACCGTGGTGTTCGATCCCCCCTTGCCG
CCGTGCAAGACTGGCGTCATTGAGCGTCTTGGCTTTGGCATCCTCAACAAAGTCGTTCTCGTATATCAAGAGGTC
TTCTGGGAAGCAGAGAGACACATCTTTGGTGTTCTCAGAGACGCCGCCAATCGCCACAGCACAGCACAAAAGGAT
TACGCCAGCAGCCGTGGCCGTTTTTTCCAATGGTTCAATGTGACCAGCTCGACTGGCTTACCATGCCTCATTGCC
CTCATGGCGGGAGACGCTGGCCACGAGACGGAGCATTGCAGCAACAACCACCTCATCTCCGAGGCCACTGGAATA
CTTCGGGCCGTTTTCGGACGTGATATTCCCTATCCCGTTGAGGCAGTCGTGACACGATGGGGGTCTGACCGGTTT
GCCCGGGGCAGCTACTCGTCGGCGGGTCCCGACATGCTCCCGGACGATTATGATAGCATGGCACGGCCTTTGGGC
AATCTTTTCTTTGCTGGTGAGCACACAATCGGTACGCACCCAGCAACTGTTCACGGCGCATACCTGTCGGGCCTT
CGCGCTGCCTCGGAGGTTTTGGAAGCCATGGTGGGACCCATTCAAGTGCCGACGCCCCTCATCCTGACCAAGGAC
TCGCTGCTGCTGCATAAGCGTAAAGAAGCGGCCAAGGATCCAAAACAGGCCCGGTTAGAGGCATATGAGATGGAA
GTCTGGGACCATGTTCGATCGCAAATTGGCGAGCGTCCGGCGCGGCCGAGCAAGGTGTCGGGAAACGCCTACCTG
CTCTACAGCAAGGCTAATTTTGACGAAGCGCGAAGGCGTTGCGAACAGAACCGCAAACCAGGAAGAGTCAGGTCC
GCTCCCAACGAGGTGCGCGTCATGACGTCGCGCATGTGGAGGGACGCCACGGTCCAAGAGCGTAAACCATTTGAG
GAGCAGGCGACGCAGCAGAAGAAGGCGTATGCAAATGCCATGCAGATATTCAACCAGACATCACAAGCTTGGGAC
CAAAAGGCAGCCACGCTGCGCAAGGCGTATGAACAAGAGCATCCCTTCATGTCGGGCCCGGATGAATCGAGTCAA
GATCATGGCTACACGTCGCACAAACACCGCCGCGCCAAACACGTTAGCTATGCGGAAAATGGACGCATGAGCTAA
Transcript >OphauG2|4301
ATGTCCATGACAATTGGCCCTGATGTCGACATGGACACGACAGTCGGAAGCCGCTATCTGGCCACCGACGCACTC
TTTAGCGCCGCCCTGAGTGAAGTTGAGGATTTGGATTCGCTGTCGTCGCCCCCGGCGGCTGAATCTATACACGTT
ACTCATCCACAACCGGGCGGCGTGTCGTTACTGCCTCTTGCGAGTTCACCATGCCTCGAGCACTCAGCCGCCTCT
TCAGGGGAAGCGTCAAAGCAGCCCTCGGAAGCTGCTCCGGAGATTGTGGTCAGGGCAGTTGAAAGCCGCCCTCAT
CATGGCAGCCGTGGCGAGGCCGACGATTTTTCACCCATGGACGTCGATTTTGACGACGCCTCTCCTGAAGACGGT
GACGTTGAACTCTTGGATGTCGTCGACAAGACTGCAATCGGCTCTTTTGCATCATCCTTGTCAGCCATGACTGAG
GTATCGGAGACATCATCATTATCATCGGCAGACTCGAGCAAAGCTACTACCCCTGCTGCTGCAGAGCTGGGGCAT
AGGGACATGCAGACGGACCAAGCTGTCAAGCCGCCTCTATATCGGCACAGCATTGAGCGGCTCAACTTTGTTGTC
CGGCCCAAATCATCTATCCCTGCAAATATTCCATCGTATCAATATGCCGGTGAGTGCATTGAAGCAGCCGAGTCG
TCCCGTTTGAATCCCTATGCCCTACATCCTGAAGAATACAATTTGTTGCGCCACCACATCTCATACACCCAAGTC
ACGACCTATCTCAACATTCGAAATAGTATCCTGCGTATCTGGATGCGGCATCCCTGGACCGCCGTTAGCCGGCAT
GATGCTATTGGCTGCACAAACGCACGCTGGTTTGATGCTGCCAGTGTATGCTATGATTGGCTGGTCCGCCGCGGC
TACATCAACTTTGGCTGTGTCAAATCTCTTCCAGAAGCCAGCGCGATGGAGCCCATTGCGCCGCAGGCAAAGAAG
CAAAGGACGGTAGTGGTTGTTGGCGCTGGCATCTCTGGCCTGGCCTGCGCGCGGCAGTTGGAAGGGTTGTTCAAA
CAGTACGCCGATTACTACCGCGATATTGGCGAGGTACCGCCCAGGGTAATAATTGTCGAGGGGAGGAGTCGTGTA
GGAGGCAGAGTGTACTCTCGCGAATTCAAGTCGAGGCCGATTGGTCAAGATCAGTCCGAGTTGCCTGCTAAGAGA
CATACTGCCGAGATGGGCGGCATGATTATCACCGGCTTCGACCGCGGCAATCCCATGAACGTCATTGTTCGTGCC
CAGCTGGGCCTACCCTATCATGTCTTGCGAGCAGACACTACCATATATGACAGCAACGGCAAGCCGGTAGACTCT
GTCCGGGACGAGCTGGTGGAAAAACTCTACAACGACTGTCTGGATCGTGTCAGCGAGTTCAAGCTCAAGGCGCAG
CCTTCCAAGCTGATTGAGGGCAACCGAGATCTCATCAACGACGCCCGCGACAGCCCCAGTGACGGCACCAAGTCG
ATTGCTCAGGCAGAAGAGGCGGCAGCAGCTCTTCCCCATGCCCCTCCAGTGTCGCAGCTCAATGTGTCTGACAAG
GTTGATATGATACCTGTATCTTCGGATAAATTGACGGGTCGCGTACACAATGTGCCTGGTGTGCCGGCCATCTTG
AAGGCTGGGGAAAAGGCCAAGCTCATGGGCTGGAATCTGAGAAGTGGCGTCAATGGCGATCAAGACATTCAACTC
GGCGATGCGGCTCATGGCCAAGGCGCAACGCTGGGATCCGTGCTGGACCATGCCATTGCCCAGTACAAGACATTT
GTGGACTTGACGGCTCAGGACCACCGCCTCATCAACTGGCACGTTGCCAATCTGGAGTACAGCAACGCAGCCAAC
CTGCACAGCCTCAGTCTTGGCTTGTGGGACATTGACGCAGGCAACGAGTGGGAGGGCCATCACACCATGGTGGAT
GGTGGCTACCAAAGCGTTGCGCGAGGTTTACTCCAGTGCCCCAGTACCTTGAACCTGACAACCAGGTTTGCTGTG
AAGCAAATCACGTACCAAGGCCATGGCTCCTCGGGTTCCGCCCTTGTTGAGGCCGAGGATGGTACGACGATAGAG
GCCGATTTTGTAGTCTGCACCGTACCATTGGGGGTTCTGAAGCAGGGCACCGTGGTGTTCGATCCCCCCTTGCCG
CCGTGCAAGACTGGCGTCATTGAGCGTCTTGGCTTTGGCATCCTCAACAAAGTCGTTCTCGTATATCAAGAGGTC
TTCTGGGAAGCAGAGAGACACATCTTTGGTGTTCTCAGAGACGCCGCCAATCGCCACAGCACAGCACAAAAGGAT
TACGCCAGCAGCCGTGGCCGTTTTTTCCAATGGTTCAATGTGACCAGCTCGACTGGCTTACCATGCCTCATTGCC
CTCATGGCGGGAGACGCTGGCCACGAGACGGAGCATTGCAGCAACAACCACCTCATCTCCGAGGCCACTGGAATA
CTTCGGGCCGTTTTCGGACGTGATATTCCCTATCCCGTTGAGGCAGTCGTGACACGATGGGGGTCTGACCGGTTT
GCCCGGGGCAGCTACTCGTCGGCGGGTCCCGACATGCTCCCGGACGATTATGATAGCATGGCACGGCCTTTGGGC
AATCTTTTCTTTGCTGGTGAGCACACAATCGGTACGCACCCAGCAACTGTTCACGGCGCATACCTGTCGGGCCTT
CGCGCTGCCTCGGAGGTTTTGGAAGCCATGGTGGGACCCATTCAAGTGCCGACGCCCCTCATCCTGACCAAGGAC
TCGCTGCTGCTGCATAAGCGTAAAGAAGCGGCCAAGGATCCAAAACAGGCCCGGTTAGAGGCATATGAGATGGAA
GTCTGGGACCATGTTCGATCGCAAATTGGCGAGCGTCCGGCGCGGCCGAGCAAGGTGTCGGGAAACGCCTACCTG
CTCTACAGCAAGGCTAATTTTGACGAAGCGCGAAGGCGTTGCGAACAGAACCGCAAACCAGGAAGAGTCAGGTCC
GCTCCCAACGAGGTGCGCGTCATGACGTCGCGCATGTGGAGGGACGCCACGGTCCAAGAGCGTAAACCATTTGAG
GAGCAGGCGACGCAGCAGAAGAAGGCGTATGCAAATGCCATGCAGATATTCAACCAGACATCACAAGCTTGGGAC
CAAAAGGCAGCCACGCTGCGCAAGGCGTATGAACAAGAGCATCCCTTCATGTCGGGCCCGGATGAATCGAGTCAA
GATCATGGCTACACGTCGCACAAACACCGCCGCGCCAAACACGTTAGCTATGCGGAAAATGGACGCATGAGCTAA
Gene >OphauG2|4301
ATGTCCATGACAATTGGCCCTGATGTCGACATGGACACGACAGTCGGAAGCCGCTATCTGGCCACCGACGCACTC
TTTAGCGCCGCCCTGAGTGAAGTTGAGGATTTGGATTCGCTGTCGTCGCCCCCGGCGGCTGAATCTATACACGTT
ACTCATCCACAACCGGGCGGCGTGTCGTTACTGCCTCTTGCGAGTTCACCATGCCTCGAGCACTCAGCCGCCTCT
TCAGGGGAAGCGTCAAAGCAGCCCTCGGAAGCTGCTCCGGAGATTGTGGTCAGGGCAGTTGAAAGCCGCCCTCAT
CATGGCAGCCGTGGCGAGGCCGACGATTTTTCACCCATGGACGTCGATTTTGAGTAAGTCTGCTTCTGTCTTTTG
TTTGGCTCCTCTCTGCCCTGGTGTCCTTGGCTTCATGTTTTCTTCTTCTTCATTTTGACGCTCCGTGTCGACAGC
GACGCCTCTCCTGAAGACGGTGACGTTGAACTCTTGGATGTCGTCGACAAGACTGCAATCGGCTCTTTTGCATCA
TCCTTGTCAGCCATGACTGAGGTATCGGAGACATCATCATTATCATCGGCAGACTCGAGCAAAGCTACTACCCCT
GCTGCTGCAGAGCTGGGGCATAGGGACATGCAGACGGACCAAGCTGTCAAGCCGCCTCTATATCGGCACAGCATT
GAGCGGCTCAACTTTGTTGTCCGGCCCAAATCATCTATCCCTGCAAATATTCCATCGTATCAATATGCCGGTGAG
TGCATTGAAGCAGCCGAGTCGTCCCGTTTGAATCCCTATGCCCTACATCCTGAAGAATACAATTTGTTGCGCCAC
CACATCTCATACACCCAAGTCACGACCTATCTCAACATTCGAAATAGTATCCTGCGTATCTGGATGCGGCATCCC
TGGACCGCCGTTAGCCGGCATGATGCTATTGGCTGCACAAACGCACGCTGGTTTGATGCTGCCAGTGTATGCTAT
GATTGGCTGGTCCGCCGCGGCTACATCAACTTTGGCTGTGTCAAATCTCTTCCAGAAGCCAGCGCGATGGAGCCC
ATTGCGCCGCAGGCAAAGAAGCAAAGGACGGTAGTGGTTGTTGGCGCTGGCATCTCTGGCCTGGCCTGCGCGCGG
CAGTTGGAAGGGTTGTTCAAACAGTACGCCGATTACTACCGCGATATTGGCGAGGTACCGCCCAGGGTAATAATT
GTCGAGGGGAGGAGTCGTGTAGGAGGCAGAGTGTACTCTCGCGAATTCAAGTCGAGGCCGATTGGTCAAGATCAG
TCCGAGTTGCCTGCTAAGAGACATACTGCCGAGATGGGCGGCATGATTATCACCGGCTTCGACCGCGGCAATCCC
ATGAACGTCATTGTTCGTGCCCAGCTGGGCCTACCCTATCATGTCTTGCGAGCAGACACTACCATATATGACAGC
AACGGCAAGCCGGTAGACTCTGTCCGGGACGAGCTGGTGGAAAAACTCTACAACGACTGTCTGGATCGTGTCAGC
GAGTTCAAGCTCAAGGCGCAGCCTTCCAAGCTGATTGAGGGCAACCGAGATCTCATCAACGACGCCCGCGACAGC
CCCAGTGACGGCACCAAGTCGATTGCTCAGGCAGAAGAGGCGGCAGCAGCTCTTCCCCATGCCCCTCCAGTGTCG
CAGCTCAATGTGTCTGACAAGGTTGATATGATACCTGTATCTTCGGATAAATTGACGGGTCGCGTACACAATGTG
CCTGGTGTGCCGGCCATCTTGAAGGCTGGGGAAAAGGCCAAGCTCATGGGCTGGAATCTGAGAAGTGGCGTCAAT
GGCGATCAAGACATTCAACTCGGCGATGCGGCTCATGGCCAAGGCGCAACGCTGGGATCCGTGCTGGACCATGCC
ATTGCCCAGTACAAGACATTTGTGGACTTGACGGCTCAGGACCACCGCCTCATCAACTGGCACGTTGCCAATCTG
GAGTACAGCAACGCAGCCAACCTGCACAGCCTCAGTCTTGGCTTGTGGGACATTGACGCAGGCAACGAGTGGGAG
GGCCATCACACCATGGTGGATGGTGGCTACCAAAGCGTTGCGCGAGGTTTACTCCAGTGCCCCAGTACCTTGAAC
CTGACAACCAGGTTTGCTGTGAAGCAAATCACGTACCAAGGCCATGGCTCCTCGGGTTCCGCCCTTGTTGAGGCC
GAGGATGGTACGACGATAGAGGCCGATTTTGTAGTCTGCACCGTACCATTGGGGGTTCTGAAGCAGGGCACCGTG
GTGTTCGATCCCCCCTTGCCGCCGTGCAAGACTGGCGTCATTGAGCGTCTTGGCTTTGGCATCCTCAACAAAGTC
GTTCTCGTATATCAAGAGGTCTTCTGGGAAGCAGAGAGACACATCTTTGGTGTTCTCAGAGACGCCGCCAATCGC
CACAGCACAGCACAAAAGGATTACGCCAGCAGCCGTGGCCGTTTTTTCCAATGGTTCAATGTGACCAGCTCGACT
GGCTTACCATGCCTCATTGCCCTCATGGCGGGAGACGCTGGCCACGAGACGGAGCATTGCAGCAACAACCACCTC
ATCTCCGAGGCCACTGGAATACTTCGGGCCGTTTTCGGACGTGATATTCCCTATCCCGTTGAGGCAGTCGTGACA
CGATGGGGGTCTGACCGGTTTGCCCGGGGCAGCTACTCGTCGGCGGGTCCCGACATGCTCCCGGACGATTATGAT
AGCATGGCACGGCCTTTGGGCAATCTTTTCTTTGCTGGTGAGCACACAATCGGTACGCACCCAGCAACTGTTCAC
GGCGCATACCTGTCGGGCCTTCGCGCTGCCTCGGAGGTTTTGGAAGCCATGGTGGGACCCATTCAAGTGCCGACG
CCCCTCATCCTGACCAAGGACTCGCTGCTGCTGCATAAGCGTAAAGAAGCGGCCAAGGATCCAAAACAGGCCCGG
TTAGAGGCATATGAGATGGAAGTCTGGGACCATGTTCGATCGCAAATTGGCGAGCGTCCGGCGCGGCCGAGCAAG
GTGTCGGGAAACGCCTACCTGCTCTACAGCAAGGCTAATTTTGACGAAGCGCGAAGGCGTTGCGAACAGAACCGC
AAACCAGGAAGAGTCAGGTCCGCTCCCAACGAGGTGCGCGTCATGACGTCGCGCATGTGGAGGGACGCCACGGTC
CAAGAGCGTAAACCATTTGAGGAGCAGGCGACGCAGCAGAAGAAGGCGTATGCAAATGCCATGCAGATATTCAAC
CAGACATCACAAGCTTGGGACCAAAAGGCAGCCACGCTGCGCAAGGCGTATGAACAAGAGCATCCCTTCATGTCG
GGCCCGGATGAATCGAGTCAAGATCATGGCTACACGTCGCACAAACACCGCCGCGCCAAACACGTTAGCTATGCG
GAAAATGGACGCATGAGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail