Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4296
Gene name
LocationContig_353:13840..15431
Strand+
Gene length (bp)1591
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 6.7E-17 114 221
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.9E-14 115 396
PF12146 Hydrolase_4 Serine aminopeptidase, S33 4.4E-08 110 365

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 114 413 2.0E-44
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 114 413 9.0E-44
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 114 404 1.0E-39
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 114 402 2.0E-37
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 96 402 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 114 413 2.0E-44
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 114 413 9.0E-44
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 114 404 1.0E-39
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 114 402 2.0E-37
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 96 402 5.0E-19
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 93 404 8.0E-18
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 108 403 1.0E-15
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 65 402 1.0E-14
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 96 411 3.0E-13
sp|G5EDL5|CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans GN=ceeh-2 PE=1 SV=1 107 395 4.0E-11
sp|P26174|BCHO_RHOCA Magnesium-chelatase 30 kDa subunit OS=Rhodobacter capsulatus GN=bchO PE=3 SV=1 106 404 1.0E-09
sp|P64302|DHMA1_MYCBO Haloalkane dehalogenase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dhmA1 PE=3 SV=1 94 239 1.0E-09
sp|P9WMS2|DHMA1_MYCTO Haloalkane dehalogenase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dhmA1 PE=3 SV=1 94 239 1.0E-09
sp|P9WMS3|DHMA1_MYCTU Haloalkane dehalogenase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dhmA1 PE=1 SV=1 94 239 1.0E-09
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 94 407 1.0E-08
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 86 406 1.0E-08
sp|B2HJU9|DHMA_MYCMM Haloalkane dehalogenase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=dhmA PE=3 SV=1 80 201 2.0E-08
sp|Q73Y99|DHMA_MYCPA Haloalkane dehalogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dhmA PE=3 SV=1 94 204 7.0E-08
sp|Q93K00|DHMA_MYCAV Haloalkane dehalogenase OS=Mycobacterium avium GN=dhmA PE=1 SV=1 94 204 7.0E-08
sp|Q1QBB9|DHMA_PSYCK Haloalkane dehalogenase OS=Psychrobacter cryohalolentis (strain K5) GN=dhmA PE=3 SV=1 97 201 5.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup680
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4296 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5195
Ophiocordyceps camponoti-floridani Ophcf2|06542
Ophiocordyceps camponoti-rufipedis Ophun1|5931
Ophiocordyceps kimflemingae Ophio5|3209
Ophiocordyceps subramaniannii Hirsu2|11072

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4296
MYLRCWWFNLGFPNPAQYCTVDEALWHRDLSVTLICQREKNIVHRLKSLPQEQQNLFLPFIQRSATAASRSRSAM
DTSKLKANDARVQNASFTTRGLTYEYMIGEPQDKPPVGTVLLLHGFPDTSFGWRCQVPFLMARGLRVIVPDLLGY
AGSSTPTNLEDMSLKNMSEDMKNLVHHVAGHDQQIILGGHDWGGHFAWRMALWQRQIIKCVFSICTPFFAPSPYS
FEDLVRSGKLPNFGYQLQFIGPDVEREIQGETKMRQLINALYSGKGPEGEVGFSVHKGVIFKNLEKLGKTPSLTE
EELDHHVAKFMLQKAPQMRGPLNWYRTGAINRGDEKEIAEKDIVFEMPTLFIAATKDLALPPHLAKNMESCMPKL
TRGEVDSTHWALTEAADEVNDIIGKWLSNIVDETSKASL*
Coding >OphauG2|4296
ATGTACTTGCGGTGTTGGTGGTTCAACCTCGGCTTCCCAAACCCCGCACAATACTGCACTGTTGACGAGGCCTTG
TGGCACCGTGATCTGTCTGTCACCTTGATCTGTCAACGCGAAAAGAATATCGTGCACAGGTTAAAAAGTCTCCCT
CAGGAGCAACAAAACCTGTTTTTGCCATTCATTCAGAGATCAGCAACAGCAGCAAGCCGCAGCCGTAGCGCTATG
GATACGAGTAAACTCAAAGCAAATGATGCTCGAGTTCAAAATGCCAGCTTCACTACCCGCGGCCTGACCTATGAG
TACATGATTGGAGAGCCACAGGACAAGCCACCAGTCGGAACCGTTTTGCTCCTGCATGGCTTTCCCGATACTAGC
TTCGGGTGGCGATGCCAGGTGCCCTTTTTAATGGCACGGGGCTTGCGTGTCATTGTTCCGGACTTGCTTGGCTAC
GCCGGTTCCAGCACTCCCACTAATCTCGAGGACATGTCGCTCAAGAATATGTCCGAAGACATGAAGAATCTCGTC
CATCATGTTGCTGGTCATGACCAACAGATTATTCTCGGCGGCCACGATTGGGGTGGCCATTTTGCGTGGAGAATG
GCCTTGTGGCAGCGCCAGATCATCAAATGCGTCTTTTCCATTTGCACCCCATTCTTTGCCCCTAGCCCCTACAGT
TTTGAGGATCTTGTCAGGAGTGGCAAACTACCCAACTTTGGGTACCAACTGCAGTTTATAGGACCAGACGTTGAG
CGCGAAATCCAAGGCGAAACCAAAATGCGCCAGCTCATCAACGCCTTGTATTCCGGCAAGGGCCCTGAGGGTGAG
GTTGGATTCTCAGTGCACAAAGGCGTCATATTCAAAAACCTTGAAAAGCTGGGCAAAACGCCAAGTCTGACGGAA
GAGGAGCTCGACCATCATGTTGCAAAATTCATGCTTCAAAAGGCGCCGCAAATGCGCGGGCCACTCAACTGGTAC
CGAACGGGTGCCATCAACAGAGGAGATGAAAAAGAGATTGCCGAAAAGGACATTGTTTTCGAAATGCCAACCCTA
TTCATTGCCGCGACAAAGGACTTGGCCCTGCCGCCACACTTGGCGAAAAACATGGAGTCGTGCATGCCCAAGCTG
ACTCGAGGCGAGGTTGACAGCACGCACTGGGCTTTGACCGAGGCAGCAGATGAGGTCAATGACATTATTGGCAAG
TGGTTGAGCAACATTGTGGATGAGACGTCGAAAGCGTCGCTGTAG
Transcript >OphauG2|4296
ATGTACTTGCGGTGTTGGTGGTTCAACCTCGGCTTCCCAAACCCCGCACAATACTGCACTGTTGACGAGGCCTTG
TGGCACCGTGATCTGTCTGTCACCTTGATCTGTCAACGCGAAAAGAATATCGTGCACAGGTTAAAAAGTCTCCCT
CAGGAGCAACAAAACCTGTTTTTGCCATTCATTCAGAGATCAGCAACAGCAGCAAGCCGCAGCCGTAGCGCTATG
GATACGAGTAAACTCAAAGCAAATGATGCTCGAGTTCAAAATGCCAGCTTCACTACCCGCGGCCTGACCTATGAG
TACATGATTGGAGAGCCACAGGACAAGCCACCAGTCGGAACCGTTTTGCTCCTGCATGGCTTTCCCGATACTAGC
TTCGGGTGGCGATGCCAGGTGCCCTTTTTAATGGCACGGGGCTTGCGTGTCATTGTTCCGGACTTGCTTGGCTAC
GCCGGTTCCAGCACTCCCACTAATCTCGAGGACATGTCGCTCAAGAATATGTCCGAAGACATGAAGAATCTCGTC
CATCATGTTGCTGGTCATGACCAACAGATTATTCTCGGCGGCCACGATTGGGGTGGCCATTTTGCGTGGAGAATG
GCCTTGTGGCAGCGCCAGATCATCAAATGCGTCTTTTCCATTTGCACCCCATTCTTTGCCCCTAGCCCCTACAGT
TTTGAGGATCTTGTCAGGAGTGGCAAACTACCCAACTTTGGGTACCAACTGCAGTTTATAGGACCAGACGTTGAG
CGCGAAATCCAAGGCGAAACCAAAATGCGCCAGCTCATCAACGCCTTGTATTCCGGCAAGGGCCCTGAGGGTGAG
GTTGGATTCTCAGTGCACAAAGGCGTCATATTCAAAAACCTTGAAAAGCTGGGCAAAACGCCAAGTCTGACGGAA
GAGGAGCTCGACCATCATGTTGCAAAATTCATGCTTCAAAAGGCGCCGCAAATGCGCGGGCCACTCAACTGGTAC
CGAACGGGTGCCATCAACAGAGGAGATGAAAAAGAGATTGCCGAAAAGGACATTGTTTTCGAAATGCCAACCCTA
TTCATTGCCGCGACAAAGGACTTGGCCCTGCCGCCACACTTGGCGAAAAACATGGAGTCGTGCATGCCCAAGCTG
ACTCGAGGCGAGGTTGACAGCACGCACTGGGCTTTGACCGAGGCAGCAGATGAGGTCAATGACATTATTGGCAAG
TGGTTGAGCAACATTGTGGATGAGACGTCGAAAGCGTCGCTGTAG
Gene >OphauG2|4296
ATGTACTTGCGGTGTTGGTGGTTCAACCTCGGCTTCCCAAACCCCGCACAATACTGCGTAACATGGTAGATACAG
AGTACATTTCAGAGCCCTAATCCCGTTCCCGCCGGGAAACAAGATCTGGACGCCTAGCAGATGAATATATAGCCC
AATCGTCGTCTCCAGAATCGGTGCTAAATACCGAGTGTTTCCTAGACTGTTGACGAGGCCTTGTGGCACCGTGAT
CTGTCTGTCACCTTGATCTGTCAACGCGAAAAGAATATCGTGCACAGGTTAAAAAGTCTCCCTCAGGAGCAACAA
AGTAAGTAACAACGCACGCTGCGCATCACCAGGTCGCCCACGGTTGGTCCTCCTGTCTGCCTGGGTTGAAAACTC
ATGGCTACTCGACAGACGACGGCACCAGGTTATACCGAGTCCCGAGACACAGCATGCCCTCATTGCACATTCTTA
AGCAGTCCGCTAGAACAAGTCAAACCAAACTAAAAAGACTGACAGTAGCTCTGCATTAGACCTGTTTTTGCCATT
CATTCAGAGATCAGCAACAGCAGCAAGCCGCAGCCGTAGCGCTATGGATACGAGTAAACTCAAAGCAAATGATGC
TCGAGTTCAAAATGCCAGCTTCACTACCCGCGGCCTGACCTATGAGTACATGATTGGAGAGCCACAGGACAAGCC
ACCAGTCGGAACCGTTTTGCTCCTGCATGGCTTTCCCGATACTAGCTTCGGGTGGCGATGCCAGGTGCCCTTTTT
AATGGCACGGGGCTTGCGTGTCATTGTTCCGGACTTGCTTGGCTACGCCGGTTCCAGCACTCCCACTAATCTCGA
GGACATGTCGCTCAAGAATATGTCCGAAGACATGAAGAATCTCGTCCATCATGTTGCTGGTCATGACCAACAGAT
TATTCTCGGCGGCCACGATTGGGGTGGCCATTTTGCGTGGAGAATGGCCTTGTGGCAGCGCCAGATCATCAAATG
CGTCTTTTCCATTTGCACCCCATTCTTTGCCCCTAGCCCCTACAGTTTTGAGGATCTTGTCAGGAGTGGCAAACT
ACCCAACTTTGGGTACCAACTGCAGTTTATAGGACCAGACGTTGAGCGCGAAATCCAAGGCGAAACCAAAATGCG
CCAGCTCATCAACGCCTTGTATTCCGGCAAGGGCCCTGAGGGTGAGGTTGGATTCTCAGTGCACAAAGGCGTCAT
ATTCAAAAACCTTGAAAAGCTGGGCAAAACGCCAAGTCTGACGGAAGAGGAGCTCGACCATCATGTTGCAAAATT
CATGCTTCAAAAGGCGCCGCAAATGCGCGGGCCACTCAACTGGTACCGAACGGGTGCCATCAACAGAGGAGATGA
AAAAGAGATTGCCGAAAAGGACATTGTTTTCGAAATGCCAACCCTATTCATTGCCGCGACAAAGGACTTGGCCCT
GCCGCCACACTTGGCGAAAAACATGGAGTCGTGCATGCCCAAGCTGACTCGAGGCGAGGTTGACAGCACGCACTG
GGCTTTGACCGAGGCAGCAGATGAGGTCAATGACATTATTGGCAAGTGGTTGAGCAACATTGTGGATGAGACGTC
GAAAGCGTCGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail