Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4294
Gene name
LocationContig_353:11318..11862
Strand-
Gene length (bp)544
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03660 PHF5 PHF5-like protein 3.7E-52 1 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WMV8|PHF5B_ARATH PHD finger-like domain-containing protein 5B OS=Arabidopsis thaliana GN=At1g07170 PE=2 SV=1 1 103 1.0E-56
sp|P0DI19|PHF5A_ARATH PHD finger-like domain-containing protein 5A OS=Arabidopsis thaliana GN=At2g30000 PE=3 SV=1 1 103 1.0E-56
sp|P83871|PHF5A_RAT PHD finger-like domain-containing protein 5A OS=Rattus norvegicus GN=Phf5a PE=2 SV=1 1 103 1.0E-54
sp|P83870|PHF5A_MOUSE PHD finger-like domain-containing protein 5A OS=Mus musculus GN=Phf5a PE=1 SV=1 1 103 1.0E-54
sp|Q7RTV0|PHF5A_HUMAN PHD finger-like domain-containing protein 5A OS=Homo sapiens GN=PHF5A PE=1 SV=1 1 103 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WMV8|PHF5B_ARATH PHD finger-like domain-containing protein 5B OS=Arabidopsis thaliana GN=At1g07170 PE=2 SV=1 1 103 1.0E-56
sp|P0DI19|PHF5A_ARATH PHD finger-like domain-containing protein 5A OS=Arabidopsis thaliana GN=At2g30000 PE=3 SV=1 1 103 1.0E-56
sp|P83871|PHF5A_RAT PHD finger-like domain-containing protein 5A OS=Rattus norvegicus GN=Phf5a PE=2 SV=1 1 103 1.0E-54
sp|P83870|PHF5A_MOUSE PHD finger-like domain-containing protein 5A OS=Mus musculus GN=Phf5a PE=1 SV=1 1 103 1.0E-54
sp|Q7RTV0|PHF5A_HUMAN PHD finger-like domain-containing protein 5A OS=Homo sapiens GN=PHF5A PE=1 SV=1 1 103 1.0E-54
sp|Q9UTB8|INI1_SCHPO Pre-mRNA-splicing factor ini1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ini1 PE=3 SV=1 1 109 2.0E-54
sp|Q9VMC8|PHF5_DROME Uncharacterized protein CG9548 OS=Drosophila melanogaster GN=CG9548 PE=3 SV=2 1 103 2.0E-53
sp|Q06835|RDS3_YEAST Pre-mRNA-splicing factor RDS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDS3 PE=1 SV=1 1 103 1.0E-41
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0016071 mRNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0006397 mRNA processing No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008380 RNA splicing No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1876
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4294 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5193
Ophiocordyceps camponoti-floridani Ophcf2|06540
Ophiocordyceps camponoti-rufipedis Ophun1|5929
Ophiocordyceps kimflemingae Ophio5|3211
Ophiocordyceps subramaniannii Hirsu2|1918

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4294
MSRHHPDLVMCRKQPGIAIGRLCDKCDGKCPVCDSYVRPTTLVRICDECSFGNYQNKCVVCGGDGISDAFYCFEC
TRLEKDRDGCPKIINLGSSRTDLFYQKKTNRTANY*
Coding >OphauG2|4294
ATGTCTCGCCACCACCCCGACCTCGTCATGTGCCGCAAGCAGCCCGGCATCGCCATCGGCCGTCTCTGCGACAAA
TGCGACGGCAAATGCCCCGTCTGCGACTCGTATGTTCGCCCAACAACTCTCGTGCGCATCTGCGACGAGTGCAGC
TTTGGCAACTACCAAAATAAATGCGTCGTCTGTGGCGGCGACGGCATTTCCGACGCGTTTTACTGCTTTGAATGT
ACTCGCCTCGAAAAGGATCGCGACGGTTGTCCCAAAATCATCAACCTCGGCAGTTCCCGCACAGACTTATTCTAT
CAAAAGAAAACGAATCGGACAGCAAACTACTAG
Transcript >OphauG2|4294
ATGTCTCGCCACCACCCCGACCTCGTCATGTGCCGCAAGCAGCCCGGCATCGCCATCGGCCGTCTCTGCGACAAA
TGCGACGGCAAATGCCCCGTCTGCGACTCGTATGTTCGCCCAACAACTCTCGTGCGCATCTGCGACGAGTGCAGC
TTTGGCAACTACCAAAATAAATGCGTCGTCTGTGGCGGCGACGGCATTTCCGACGCGTTTTACTGCTTTGAATGT
ACTCGCCTCGAAAAGGATCGCGACGGTTGTCCCAAAATCATCAACCTCGGCAGTTCCCGCACAGACTTATTCTAT
CAAAAGAAAACGAATCGGACAGCAAACTACTAG
Gene >OphauG2|4294
ATGTCTCGCCACCACCCGTAAGTACAGTACAACAAAGCCTTCTCCTTTCCCGAGAAAGATTGCCTACTCATCCTC
ATCTGTAGCGACCTCGTCATGTGCCGCAAGCAGCCCGGCATCGCCATCGGCCGTCTCTGCGACAAATGCGACGGC
AAATGCCCCGTCTGCGACTCGTATGTTCGCCCAACAACTCTCGTGCGCATCTGCGACGAGTGCAGCTTTGGCAAC
TACCAAAATAAATGCGTCGTCTGTGGCGGCGACGGCATTTCCGACGCGTTTTACTGCTTTGAATGTACTCGCCTC
GAAAAGGATCGCGACGGTTGTCCCAAAATCATCAACCTCGGCAGTTCCCGCACAGACGTAAGTGACTCGAGTCCT
CTTTTCTTGCCTCGCCATTATTCCTTGGCCTGTTCCGCCTGCCTAGAGCCCTGTGTCTTGGGTTTGACTGCTATG
AGATGCACTCTTGAGCTGACCACCTTGTCATCTTTCTCTCTCCTCTTTGCAGTTATTCTATCAAAAGAAAACGAA
TCGGACAGCAAACTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail