Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4290
Gene name
LocationContig_353:4377..4948
Strand+
Gene length (bp)571
Transcript length (bp)345
Coding sequence length (bp)345
Protein length (aa) 115

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01910 Thiamine_BP Thiamine-binding protein 1.8E-30 15 105

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35195|ECM15_YEAST UPF0045 protein ECM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM15 PE=1 SV=1 13 105 1.0E-28
sp|Q8J1F7|ECM15_ASHGO UPF0045 protein ECM15 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ECM15 PE=3 SV=1 15 111 2.0E-26
sp|P72699|Y230_SYNY3 UPF0045 protein sll0230 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0230 PE=3 SV=1 16 112 2.0E-24
sp|P54499|YQGV_BACSU UPF0045 protein YqgV OS=Bacillus subtilis (strain 168) GN=yqgV PE=3 SV=2 15 109 1.0E-10
sp|Q56200|DGLA_STAXY UPF0045 protein in glkA 3'region OS=Staphylococcus xylosus GN=dglA PE=3 SV=1 16 111 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35195|ECM15_YEAST UPF0045 protein ECM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM15 PE=1 SV=1 13 105 1.0E-28
sp|Q8J1F7|ECM15_ASHGO UPF0045 protein ECM15 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ECM15 PE=3 SV=1 15 111 2.0E-26
sp|P72699|Y230_SYNY3 UPF0045 protein sll0230 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0230 PE=3 SV=1 16 112 2.0E-24
sp|P54499|YQGV_BACSU UPF0045 protein YqgV OS=Bacillus subtilis (strain 168) GN=yqgV PE=3 SV=2 15 109 1.0E-10
sp|Q56200|DGLA_STAXY UPF0045 protein in glkA 3'region OS=Staphylococcus xylosus GN=dglA PE=3 SV=1 16 111 2.0E-09
sp|Q58452|Y1052_METJA UPF0045 protein MJ1052 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1052 PE=1 SV=1 15 108 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4290
MADYASIPTPESCYADFCLIPIGTGTASVADEVAAVQRVIGASGLTHTMHSAGTTVEGSWDAVMAVMGKAHTIVH
DRGVARVQSSVRIGSRTDKKQTAREKVKRVHDLLAETAP*
Coding >OphauG2|4290
ATGGCCGACTACGCTTCCATTCCCACCCCAGAATCGTGCTACGCCGACTTTTGCCTCATTCCTATTGGCACCGGC
ACCGCCTCCGTGGCCGACGAAGTCGCCGCAGTCCAGCGCGTCATTGGCGCCAGCGGCCTGACGCACACCATGCAC
TCTGCCGGCACGACTGTCGAAGGCAGCTGGGACGCCGTCATGGCCGTCATGGGCAAAGCCCACACTATTGTCCAT
GACCGCGGCGTCGCCAGAGTTCAGTCGTCGGTCCGCATCGGCTCGCGCACCGACAAGAAGCAGACTGCCCGAGAA
AAGGTCAAGCGAGTGCACGACCTGCTGGCCGAAACTGCACCCTAA
Transcript >OphauG2|4290
ATGGCCGACTACGCTTCCATTCCCACCCCAGAATCGTGCTACGCCGACTTTTGCCTCATTCCTATTGGCACCGGC
ACCGCCTCCGTGGCCGACGAAGTCGCCGCAGTCCAGCGCGTCATTGGCGCCAGCGGCCTGACGCACACCATGCAC
TCTGCCGGCACGACTGTCGAAGGCAGCTGGGACGCCGTCATGGCCGTCATGGGCAAAGCCCACACTATTGTCCAT
GACCGCGGCGTCGCCAGAGTTCAGTCGTCGGTCCGCATCGGCTCGCGCACCGACAAGAAGCAGACTGCCCGAGAA
AAGGTCAAGCGAGTGCACGACCTGCTGGCCGAAACTGCACCCTAA
Gene >OphauG2|4290
ATGGCCGACTACGCTTCCATTCCCACCCCAGAATCGTGCTACGCCGACTTTTGCCTCATTCCTGTACAATGCCTC
TCGCCCTCAAGCCGCCTCCATCTCCCCATCACTCAACCAAATGGTCCATCCGCTGACTCGCTGGCAGATTGGCAC
CGGCACCGCCTCCGTGGCCGACGAAGTCGCCGCAGTCCAGCGCGTCATTGGCGCCAGCGGCCTGACGCACACCAT
GCACTCTGCCGGCACGACTGTCGGTGTGTCTATGCGCTTGCATCTTGGCGTCATGTATCAAGTCTGACACGGCGC
GTCTCCCGAGCAGAAGGCAGCTGGGACGCCGTCATGGCCGTCATGGGCAAAGCCCACACTATTGTCCATGACCGC
GGCGTCGCCAGAGTTCAGTCGTCGGTCCGCATCGGCTCGCGGTCAGTCTTGCCCTGAGCCTTGATCATGGCCTGT
TGATCATGGCCTGTTGATCATGGCCTGTGTGCTGACTCGCTTTGGCAGCACCGACAAGAAGCAGACTGCCCGAGA
AAAGGTCAAGCGAGTGCACGACCTGCTGGCCGAAACTGCACCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail