Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|429
Gene name
LocationContig_11:7968..8923
Strand+
Gene length (bp)955
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03271 EB1 EB1-like C-terminal motif 1.1E-15 181 226
PF00307 CH Calponin homology (CH) domain 8.9E-07 3 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10113|MAL3_SCHPO Microtubule integrity protein mal3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal3 PE=1 SV=1 1 245 3.0E-64
sp|P40013|BIM1_YEAST Protein BIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIM1 PE=1 SV=1 1 243 1.0E-62
sp|Q66T82|MARE1_COTJA Microtubule-associated protein RP/EB family member 1 OS=Coturnix coturnix japonica GN=MAPRE1 PE=2 SV=1 4 246 2.0E-58
sp|Q66HR2|MARE1_RAT Microtubule-associated protein RP/EB family member 1 OS=Rattus norvegicus GN=Mapre1 PE=1 SV=3 4 235 2.0E-58
sp|Q6V291|MARE1_COTCO Microtubule-associated protein RP/EB family member 1 OS=Coturnix coturnix GN=MAPRE1 PE=2 SV=1 4 246 3.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10113|MAL3_SCHPO Microtubule integrity protein mal3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal3 PE=1 SV=1 1 245 3.0E-64
sp|P40013|BIM1_YEAST Protein BIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIM1 PE=1 SV=1 1 243 1.0E-62
sp|Q66T82|MARE1_COTJA Microtubule-associated protein RP/EB family member 1 OS=Coturnix coturnix japonica GN=MAPRE1 PE=2 SV=1 4 246 2.0E-58
sp|Q66HR2|MARE1_RAT Microtubule-associated protein RP/EB family member 1 OS=Rattus norvegicus GN=Mapre1 PE=1 SV=3 4 235 2.0E-58
sp|Q6V291|MARE1_COTCO Microtubule-associated protein RP/EB family member 1 OS=Coturnix coturnix GN=MAPRE1 PE=2 SV=1 4 246 3.0E-58
sp|Q61166|MARE1_MOUSE Microtubule-associated protein RP/EB family member 1 OS=Mus musculus GN=Mapre1 PE=1 SV=3 4 235 2.0E-57
sp|Q3ZBD9|MARE1_BOVIN Microtubule-associated protein RP/EB family member 1 OS=Bos taurus GN=MAPRE1 PE=2 SV=3 4 235 3.0E-57
sp|Q5R7Z5|MARE1_PONAB Microtubule-associated protein RP/EB family member 1 OS=Pongo abelii GN=MAPRE1 PE=2 SV=3 4 235 4.0E-57
sp|Q15691|MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens GN=MAPRE1 PE=1 SV=3 4 235 4.0E-57
sp|Q5ZLC7|MARE1_CHICK Microtubule-associated protein RP/EB family member 1 OS=Gallus gallus GN=MAPRE1 PE=2 SV=1 4 246 2.0E-56
sp|Q6P848|MARE1_XENTR Microtubule-associated protein RP/EB family member 1 OS=Xenopus tropicalis GN=mapre1 PE=2 SV=1 4 246 4.0E-56
sp|Q9UPY8|MARE3_HUMAN Microtubule-associated protein RP/EB family member 3 OS=Homo sapiens GN=MAPRE3 PE=1 SV=1 4 244 2.0E-53
sp|Q5XIT1|MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus GN=Mapre3 PE=1 SV=1 4 244 1.0E-52
sp|Q6PER3|MARE3_MOUSE Microtubule-associated protein RP/EB family member 3 OS=Mus musculus GN=Mapre3 PE=1 SV=1 4 244 1.0E-52
sp|Q7ZXP1|MARE2_XENLA Microtubule-associated protein RP/EB family member 2 OS=Xenopus laevis GN=mapre2 PE=2 SV=1 4 229 4.0E-48
sp|Q15555|MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens GN=MAPRE2 PE=1 SV=1 4 239 6.0E-48
sp|Q5R4I6|MARE2_PONAB Microtubule-associated protein RP/EB family member 2 OS=Pongo abelii GN=MAPRE2 PE=2 SV=1 4 239 1.0E-47
sp|Q8R001|MARE2_MOUSE Microtubule-associated protein RP/EB family member 2 OS=Mus musculus GN=Mapre2 PE=1 SV=1 4 239 1.0E-46
sp|Q3B8Q0|MARE2_RAT Microtubule-associated protein RP/EB family member 2 OS=Rattus norvegicus GN=Mapre2 PE=1 SV=1 4 229 1.0E-46
sp|Q3SZP2|MARE2_BOVIN Microtubule-associated protein RP/EB family member 2 OS=Bos taurus GN=MAPRE2 PE=2 SV=1 4 228 2.0E-45
sp|Q5ZKK1|MARE2_CHICK Microtubule-associated protein RP/EB family member 2 OS=Gallus gallus GN=MAPRE2 PE=2 SV=1 4 227 2.0E-44
sp|Q9FJJ5|EB1B_ARATH Microtubule-associated protein RP/EB family member 1B OS=Arabidopsis thaliana GN=EB1B PE=1 SV=1 5 243 3.0E-44
sp|Q7XJ60|EB1A_ARATH Microtubule-associated protein RP/EB family member 1A OS=Arabidopsis thaliana GN=EB1A PE=1 SV=1 5 243 1.0E-42
sp|Q9FGQ6|EB1C_ARATH Microtubule-associated protein RP/EB family member 1C OS=Arabidopsis thaliana GN=EB1C PE=1 SV=1 5 228 5.0E-39
sp|Q8WQ86|EB1_DICDI Microtubule-associated protein RP/EB family member 1 OS=Dictyostelium discoideum GN=eb1 PE=1 SV=1 2 141 3.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008017 microtubule binding Yes
GO:0003674 molecular_function No
GO:0015631 tubulin binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|429
MGESRQDLVQWLNSLLQLNITKVEQCGTGAALCQVFDSIYVDVPMSRVKFNASGDYAYIQNFKVLQNTFTKHQID
KPIPVEALVKCKMQDNLEFLQWTKKFWDNNFPDHEYDPVARRKGSALPATAGARAPAAAASVGAGAAARRGGTTP
AGGPRVARTAGPGTAALQQENATLKETVGGLERERDFYFSKLRDIELLIQHAVDEDPELEKQEDGLIKQVQLILY
STEEGFEIPEEAEALDDQETF*
Coding >OphauG2|429
ATGGGCGAGTCAAGACAGGATCTCGTGCAATGGCTCAACAGCCTTCTCCAGCTCAACATCACCAAGGTTGAACAA
TGTGGAACAGGGGCCGCGCTGTGTCAAGTCTTTGACAGCATATACGTGGACGTGCCCATGTCCAGGGTCAAGTTC
AACGCCAGTGGCGATTACGCCTACATCCAGAACTTCAAGGTTCTCCAAAATACGTTTACCAAGCATCAGATTGAC
AAGCCTATCCCGGTCGAAGCGCTTGTCAAATGCAAGATGCAGGACAATCTCGAGTTTTTGCAGTGGACCAAGAAA
TTCTGGGACAACAACTTCCCCGACCACGAATACGATCCCGTCGCACGCCGCAAGGGGAGCGCTCTCCCTGCCACC
GCCGGAGCCCGGGCGCCTGCCGCCGCCGCTTCAGTGGGCGCTGGTGCTGCCGCCCGGAGAGGGGGCACAACACCT
GCCGGTGGCCCACGCGTCGCCCGTACTGCCGGACCCGGCACGGCGGCCCTGCAGCAAGAGAATGCCACCCTCAAA
GAGACTGTTGGCGGCCTGGAACGGGAGCGCGATTTTTACTTTAGCAAGCTGCGCGACATTGAACTCTTGATCCAG
CATGCTGTCGACGAGGACCCAGAACTGGAAAAACAGGAAGATGGCTTGATCAAACAGGTACAGTTGATTCTATAC
TCTACAGAGGAGGGCTTTGAGATCCCCGAGGAAGCAGAGGCGCTGGACGATCAGGAAACCTTTTAA
Transcript >OphauG2|429
ATGGGCGAGTCAAGACAGGATCTCGTGCAATGGCTCAACAGCCTTCTCCAGCTCAACATCACCAAGGTTGAACAA
TGTGGAACAGGGGCCGCGCTGTGTCAAGTCTTTGACAGCATATACGTGGACGTGCCCATGTCCAGGGTCAAGTTC
AACGCCAGTGGCGATTACGCCTACATCCAGAACTTCAAGGTTCTCCAAAATACGTTTACCAAGCATCAGATTGAC
AAGCCTATCCCGGTCGAAGCGCTTGTCAAATGCAAGATGCAGGACAATCTCGAGTTTTTGCAGTGGACCAAGAAA
TTCTGGGACAACAACTTCCCCGACCACGAATACGATCCCGTCGCACGCCGCAAGGGGAGCGCTCTCCCTGCCACC
GCCGGAGCCCGGGCGCCTGCCGCCGCCGCTTCAGTGGGCGCTGGTGCTGCCGCCCGGAGAGGGGGCACAACACCT
GCCGGTGGCCCACGCGTCGCCCGTACTGCCGGACCCGGCACGGCGGCCCTGCAGCAAGAGAATGCCACCCTCAAA
GAGACTGTTGGCGGCCTGGAACGGGAGCGCGATTTTTACTTTAGCAAGCTGCGCGACATTGAACTCTTGATCCAG
CATGCTGTCGACGAGGACCCAGAACTGGAAAAACAGGAAGATGGCTTGATCAAACAGGTACAGTTGATTCTATAC
TCTACAGAGGAGGGCTTTGAGATCCCCGAGGAAGCAGAGGCGCTGGACGATCAGGAAACCTTTTAA
Gene >OphauG2|429
ATGGGCGAGTCAAGGTTGGTTAGCCCTTTATTTTGGCGCGCGACTCCTGACGCTGACGCCTCGCCGTCTCCAGAC
AGGATCTCGTGCAATGGCTCAACAGCCTTCTCCAGCTCAACATCACCAAGGTTGAACAATGTGGAACAGGGTAGG
TCAAGTGATTGCTTTTTTTCGGCATTCTCTCCCCCACCCCGCCATTGGGCTCCCATGTCCATACCCTGCTTCATC
TGACGCCATAATGATAGGGCCGCGCTGTGTCAAGTCTTTGACAGCATATACGTGGACGTGCCCATGTCCAGGGTC
AAGTTCAACGCCAGTGGCGATTACGCCTACATCCAGAACTTCAAGGTTCTCCAAAGTAGGCATCTCGGTCGCGGC
GCGGTGTAAAATGATTGATGTTGACACGTGCGCTTCAGATACGTTTACCAAGCATCAGATTGACAAGCCTATCCC
GGTCGAAGCGCTTGTCAAATGCAAGATGCAGGACAATCTCGAGTTTTTGCAGTGGACCAAGAAATTCTGGGACAA
CAACTTCCCCGACCACGAATACGATCCCGTCGCACGCCGCAAGGGGAGCGCTCTCCCTGCCACCGCCGGAGCCCG
GGCGCCTGCCGCCGCCGCTTCAGTGGGCGCTGGTGCTGCCGCCCGGAGAGGGGGCACAACACCTGCCGGTGGCCC
ACGCGTCGCCCGTACTGCCGGACCCGGCACGGCGGCCCTGCAGCAAGAGAATGCCACCCTCAAAGAGACTGTTGG
CGGCCTGGAACGGGAGCGCGATTTTTACTTTAGCAAGCTGCGCGACATTGAACTCTTGATCCAGCATGCTGTCGA
CGAGGACCCAGAACTGGAAAAACAGGAAGATGGCTTGATCAAACAGGTACAGTTGATTCTATACTCTACAGAGGA
GGGCTTTGAGATCCCCGAGGAAGCAGAGGCGCTGGACGATCAGGAAACCTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail