Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4289
Gene name
LocationContig_353:2698..3838
Strand+
Gene length (bp)1140
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 40 339 4.0E-51
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 17 325 3.0E-47

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4289
MIPRPLWHLASTALFLSTLGQAAPQDGTGSVPASGPGRACNNSPSLCGRQYNKITYMGAHDSAFLRDSTTGNSLA
GNQFRNATAALDAGLRLLQAQVHRADAELRLCHSSCGLLDAGPLDAWLTAVAGWMARNPNDVVTLILVNADNAPA
SELQGHFERSGMAQFGYKPSTAPAATSDWPTLETMIGQGTRLVSFITNMEYSPATPYLLPQFNYVFETPFEVTQL
TAFNCTLDRPASMAPASNALSRNYLSLVNHFKYQNIGGGVLQSLSNLVGASSAILVPDVDRIDVTNSPNGDVDGN
LGRHVDQCRAEWQQQPNYVLVDFWDRQSPIAAADRLNGLPGTTGRRMPSTISAAHSLGASCQGLGGLVVAAVAAA
ALLL*
Coding >OphauG2|4289
ATGATACCAAGGCCCCTTTGGCACCTGGCCTCGACGGCTCTGTTCCTCAGCACTCTAGGACAGGCTGCTCCCCAA
GATGGCACGGGCTCCGTGCCGGCGTCAGGCCCAGGCCGCGCATGCAACAACTCGCCCTCTCTGTGCGGGCGGCAG
TACAACAAGATCACCTACATGGGCGCCCACGACAGCGCCTTTCTGCGCGACAGCACAACAGGCAACTCGCTCGCA
GGCAACCAGTTCCGCAACGCCACGGCCGCTCTCGACGCCGGGCTGCGGCTCCTGCAGGCCCAGGTGCATCGGGCA
GACGCGGAGCTGAGGCTATGTCACTCGTCGTGCGGTCTGCTCGACGCCGGGCCGCTGGATGCCTGGCTAACGGCC
GTGGCTGGCTGGATGGCGCGCAACCCAAACGACGTGGTGACGCTGATTCTCGTCAACGCCGACAACGCCCCGGCC
TCGGAGCTGCAGGGCCATTTTGAGCGCTCCGGCATGGCCCAGTTTGGCTACAAGCCCTCGACGGCGCCGGCAGCA
ACGAGCGACTGGCCGACGCTGGAAACCATGATTGGCCAGGGCACGCGCCTCGTGTCCTTCATCACCAACATGGAG
TACTCCCCCGCCACGCCCTACCTGCTGCCACAGTTCAACTACGTCTTTGAAACGCCCTTTGAAGTGACGCAGCTC
ACCGCCTTCAACTGCACCCTGGACCGCCCGGCCTCAATGGCGCCCGCGTCGAATGCCCTGTCGCGCAACTACCTG
AGTCTGGTGAACCACTTCAAGTATCAAAACATTGGCGGCGGCGTCCTGCAAAGCCTGTCCAACCTGGTGGGCGCC
TCCTCGGCCATTCTGGTGCCCGACGTGGACCGCATCGATGTGACAAACAGCCCCAATGGCGATGTTGACGGTAAT
CTGGGCCGCCATGTGGACCAGTGTCGCGCCGAGTGGCAGCAGCAGCCCAACTATGTCTTGGTCGACTTTTGGGAC
CGCCAAAGCCCCATTGCCGCGGCCGACCGCCTCAATGGCCTGCCGGGCACCACAGGACGCCGCATGCCGAGTACC
ATATCGGCCGCGCATAGCTTGGGCGCCTCATGCCAGGGCCTGGGCGGGCTGGTGGTGGCTGCAGTGGCGGCGGCG
GCATTGCTGTTGTGA
Transcript >OphauG2|4289
ATGATACCAAGGCCCCTTTGGCACCTGGCCTCGACGGCTCTGTTCCTCAGCACTCTAGGACAGGCTGCTCCCCAA
GATGGCACGGGCTCCGTGCCGGCGTCAGGCCCAGGCCGCGCATGCAACAACTCGCCCTCTCTGTGCGGGCGGCAG
TACAACAAGATCACCTACATGGGCGCCCACGACAGCGCCTTTCTGCGCGACAGCACAACAGGCAACTCGCTCGCA
GGCAACCAGTTCCGCAACGCCACGGCCGCTCTCGACGCCGGGCTGCGGCTCCTGCAGGCCCAGGTGCATCGGGCA
GACGCGGAGCTGAGGCTATGTCACTCGTCGTGCGGTCTGCTCGACGCCGGGCCGCTGGATGCCTGGCTAACGGCC
GTGGCTGGCTGGATGGCGCGCAACCCAAACGACGTGGTGACGCTGATTCTCGTCAACGCCGACAACGCCCCGGCC
TCGGAGCTGCAGGGCCATTTTGAGCGCTCCGGCATGGCCCAGTTTGGCTACAAGCCCTCGACGGCGCCGGCAGCA
ACGAGCGACTGGCCGACGCTGGAAACCATGATTGGCCAGGGCACGCGCCTCGTGTCCTTCATCACCAACATGGAG
TACTCCCCCGCCACGCCCTACCTGCTGCCACAGTTCAACTACGTCTTTGAAACGCCCTTTGAAGTGACGCAGCTC
ACCGCCTTCAACTGCACCCTGGACCGCCCGGCCTCAATGGCGCCCGCGTCGAATGCCCTGTCGCGCAACTACCTG
AGTCTGGTGAACCACTTCAAGTATCAAAACATTGGCGGCGGCGTCCTGCAAAGCCTGTCCAACCTGGTGGGCGCC
TCCTCGGCCATTCTGGTGCCCGACGTGGACCGCATCGATGTGACAAACAGCCCCAATGGCGATGTTGACGGTAAT
CTGGGCCGCCATGTGGACCAGTGTCGCGCCGAGTGGCAGCAGCAGCCCAACTATGTCTTGGTCGACTTTTGGGAC
CGCCAAAGCCCCATTGCCGCGGCCGACCGCCTCAATGGCCTGCCGGGCACCACAGGACGCCGCATGCCGAGTACC
ATATCGGCCGCGCATAGCTTGGGCGCCTCATGCCAGGGCCTGGGCGGGCTGGTGGTGGCTGCAGTGGCGGCGGCG
GCATTGCTGTTGTGA
Gene >OphauG2|4289
ATGATACCAAGGCCCCTTTGGCACCTGGCCTCGACGGCTCTGTTCCTCAGCACTCTAGGACAGGCTGCTCCCCAA
GATGGCACGGGCTCCGTGCCGGCGTCAGGCCCAGGCCGCGCATGCAACAACTCGCCCTCTCTGTGCGGGCGGCAG
TACAACAAGATCACCTACATGGGCGCCCACGACAGCGCCTTTCTGCGCGACAGCACAACAGGCAACTCGCTCGCA
GGCAACCAGTTCCGCAACGCCACGGCCGCTCTCGACGCCGGGCTGCGGCTCCTGCAGGCCCAGGTGCATCGGGCA
GACGCGGAGCTGAGGCTATGTCACTCGTCGTGCGGTCTGCTCGACGCCGGGCCGCTGGATGCCTGGCTAACGGCC
GTGGCTGGCTGGATGGCGCGCAACCCAAACGACGTGGTGACGCTGATTCTCGTCAACGCCGACAACGCCCCGGCC
TCGGAGCTGCAGGGCCATTTTGAGCGCTCCGGCATGGCCCAGTTTGGCTACAAGCCCTCGACGGCGCCGGCAGCA
ACGAGCGACTGGCCGACGCTGGAAACCATGATTGGCCAGGGCACGCGCCTCGTGTCCTTCATCACCAACATGGAG
TACTCCCCCGCCACGCCCTACCTGCTGCCACAGTTCAACTACGTCTTTGAAACGCCCTTTGAAGTGACGCAGCTC
ACCGCCTTCAACTGCACCCTGGACCGCCCGGCCTCAATGGCGCCCGCGTCGAATGCCCTGTCGCGCAACTACCTG
AGTCTGGTGAACCACTTCAAGTATCAAAACATTGGCGGCGGCGTCCTGCAAAGCCTGTCCAACCTGGTGGGCGCC
TCCTCGGCCATTCTGGTGCCCGACGTGGACCGCATCGATGTGACAAACAGCCCCAATGGCGATGTTGACGGTAAT
CTGGGCCGCCATGTGGACCAGTGTCGCGCCGAGTGGCAGCAGCAGCCCAACTATGTCTTGGTCGACTTTTGGGAC
CGCCAAAGCCCCATTGCCGCGGCCGACCGCCTCAATGGCCTGCCGGGCACCACAGGACGCCGCATGCCGAGTACC
ATATCGGCCGCGCATAGCTTGGGCGCCTCATGCCAGGGCCTGGGCGGGCTGGTGGTGGCTGCAGTGGCGGCGGCG
GCATTGCTGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail