Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4287
Gene name
LocationContig_353:132..1713
Strand+
Gene length (bp)1581
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03234 CDC37_N Cdc37 N terminal kinase binding 3.4E-48 2 139
PF08565 CDC37_M Cdc37 Hsp90 binding domain 7.1E-39 252 361
PF08564 CDC37_C Cdc37 C terminal domain 2.3E-26 384 476

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94740|CDC37_SCHPO Hsp90 co-chaperone Cdc37 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc37 PE=1 SV=1 1 464 5.0E-91
sp|P06101|CDC37_YEAST Hsp90 co-chaperone Cdc37 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC37 PE=1 SV=2 1 447 6.0E-68
sp|Q8X1E6|CDC37_CANAL Hsp90 co-chaperone Cdc37 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC37 PE=3 SV=1 1 447 5.0E-60
sp|Q9DGQ7|CDC37_TETFL Hsp90 co-chaperone Cdc37 OS=Tetraodon fluviatilis GN=cdc37 PE=3 SV=1 257 377 4.0E-06

GO

GO Term Description Terminal node
GO:0019901 protein kinase binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0019900 kinase binding No
GO:0019899 enzyme binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1880
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4287 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5187
Ophiocordyceps camponoti-floridani Ophcf2|06535
Ophiocordyceps camponoti-rufipedis Ophun1|5669
Ophiocordyceps kimflemingae Ophio5|3217
Ophiocordyceps subramaniannii Hirsu2|1924

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4287
MPVDYSKWDALELSDDSDIEVHPNVDKKSFIRAKRQQIHQERHHRKLQIETFKYEGIINNGLLKRISALLASLKA
HSSETATRKPAEIAFQAMMESAGDAKDDQPPPPPEGVHSEEKEQPSYSKMMAVLLDQVNKALDEKNPSDRYSAMV
AEIEEHETKIKKLQRELVVKLDEMEKEDKKKITSQDIHTGFDSSHVSKSKPSDAKKESTQVELLNPGAGASLSKS
ESCSSLAAKDDVAVKDEEVEASADAKKFARIRADDFTSSLQFLSQHPHILTERDSDGLLVMAFDAALEGKDEVSR
QCVHQALLLQYCRALGRDGVGLFFKRIMTKGHQARDVFFKDVQDTYFRIRTRSREILAERARDEGVEQIQLQAVE
PGTEIHIRVPVADSNDAEEQKARQVFDGFDTEMKKAIETGSLDEVNKMLGQMAVPEAEKMVSLFGEANVLSLVER
IYDATTEEGKQELAAMKAQAAAETEGDQDKGKGPA*
Coding >OphauG2|4287
ATGCCTGTCGACTACAGTAAATGGGATGCGCTGGAGCTGAGCGACGACTCGGACATTGAGGTGCACCCCAACGTA
GACAAAAAGTCGTTTATCCGTGCCAAGCGACAGCAGATTCATCAGGAGCGTCATCACCGGAAACTTCAAATTGAG
ACGTTCAAGTATGAAGGCATCATCAACAATGGATTGTTGAAGCGCATCTCAGCCCTGTTAGCTTCTCTCAAGGCG
CACAGTTCCGAGACAGCGACGCGCAAGCCAGCTGAGATTGCCTTTCAGGCCATGATGGAGTCGGCGGGTGATGCA
AAGGACGACCAGCCGCCCCCACCGCCTGAGGGTGTACATAGCGAAGAGAAGGAACAGCCAAGCTATTCCAAGATG
ATGGCGGTGTTACTCGACCAGGTCAACAAGGCACTGGACGAGAAAAATCCCAGCGATAGATACAGCGCCATGGTG
GCCGAAATCGAGGAGCACGAGACCAAGATCAAGAAGCTACAAAGGGAGCTAGTGGTAAAGCTTGACGAGATGGAA
AAGGAAGACAAAAAGAAGATTACGAGCCAAGACATACACACAGGGTTCGATAGTTCTCATGTCAGCAAGTCGAAG
CCGTCAGATGCCAAGAAGGAATCGACACAGGTCGAGCTGCTAAACCCCGGGGCCGGGGCGTCGCTGTCCAAGTCT
GAGTCATGCTCATCGTTGGCAGCGAAAGACGACGTAGCCGTCAAGGACGAGGAGGTGGAGGCTTCGGCGGATGCC
AAGAAGTTTGCACGGATCAGGGCCGACGACTTTACGAGCAGTCTTCAGTTCTTGTCGCAGCACCCGCACATCCTT
ACGGAGCGCGATTCGGATGGACTGTTGGTCATGGCATTTGACGCTGCACTCGAGGGCAAGGACGAGGTATCGCGA
CAGTGTGTGCACCAGGCGTTGCTACTGCAGTATTGCCGGGCCTTGGGCAGAGACGGGGTGGGGCTATTTTTCAAG
CGCATCATGACCAAGGGCCACCAGGCAAGGGACGTCTTTTTCAAGGACGTGCAAGACACGTATTTCAGAATCCGG
ACGCGGTCACGGGAAATATTGGCGGAGCGGGCTCGAGACGAAGGAGTAGAGCAGATTCAGCTGCAGGCGGTTGAG
CCGGGAACTGAAATTCACATCAGGGTGCCGGTAGCGGACAGCAACGACGCAGAAGAGCAAAAGGCGCGGCAGGTG
TTTGACGGGTTCGATACGGAAATGAAGAAGGCGATTGAGACAGGAAGTCTGGATGAGGTCAACAAGATGCTGGGG
CAGATGGCGGTGCCAGAGGCGGAGAAGATGGTCAGCTTGTTTGGAGAGGCAAACGTGCTGAGTCTTGTGGAGCGC
ATTTATGATGCTACGACGGAAGAGGGCAAACAGGAGTTGGCGGCAATGAAAGCGCAGGCAGCAGCAGAGACGGAG
GGGGACCAAGACAAAGGCAAAGGGCCTGCATAA
Transcript >OphauG2|4287
ATGCCTGTCGACTACAGTAAATGGGATGCGCTGGAGCTGAGCGACGACTCGGACATTGAGGTGCACCCCAACGTA
GACAAAAAGTCGTTTATCCGTGCCAAGCGACAGCAGATTCATCAGGAGCGTCATCACCGGAAACTTCAAATTGAG
ACGTTCAAGTATGAAGGCATCATCAACAATGGATTGTTGAAGCGCATCTCAGCCCTGTTAGCTTCTCTCAAGGCG
CACAGTTCCGAGACAGCGACGCGCAAGCCAGCTGAGATTGCCTTTCAGGCCATGATGGAGTCGGCGGGTGATGCA
AAGGACGACCAGCCGCCCCCACCGCCTGAGGGTGTACATAGCGAAGAGAAGGAACAGCCAAGCTATTCCAAGATG
ATGGCGGTGTTACTCGACCAGGTCAACAAGGCACTGGACGAGAAAAATCCCAGCGATAGATACAGCGCCATGGTG
GCCGAAATCGAGGAGCACGAGACCAAGATCAAGAAGCTACAAAGGGAGCTAGTGGTAAAGCTTGACGAGATGGAA
AAGGAAGACAAAAAGAAGATTACGAGCCAAGACATACACACAGGGTTCGATAGTTCTCATGTCAGCAAGTCGAAG
CCGTCAGATGCCAAGAAGGAATCGACACAGGTCGAGCTGCTAAACCCCGGGGCCGGGGCGTCGCTGTCCAAGTCT
GAGTCATGCTCATCGTTGGCAGCGAAAGACGACGTAGCCGTCAAGGACGAGGAGGTGGAGGCTTCGGCGGATGCC
AAGAAGTTTGCACGGATCAGGGCCGACGACTTTACGAGCAGTCTTCAGTTCTTGTCGCAGCACCCGCACATCCTT
ACGGAGCGCGATTCGGATGGACTGTTGGTCATGGCATTTGACGCTGCACTCGAGGGCAAGGACGAGGTATCGCGA
CAGTGTGTGCACCAGGCGTTGCTACTGCAGTATTGCCGGGCCTTGGGCAGAGACGGGGTGGGGCTATTTTTCAAG
CGCATCATGACCAAGGGCCACCAGGCAAGGGACGTCTTTTTCAAGGACGTGCAAGACACGTATTTCAGAATCCGG
ACGCGGTCACGGGAAATATTGGCGGAGCGGGCTCGAGACGAAGGAGTAGAGCAGATTCAGCTGCAGGCGGTTGAG
CCGGGAACTGAAATTCACATCAGGGTGCCGGTAGCGGACAGCAACGACGCAGAAGAGCAAAAGGCGCGGCAGGTG
TTTGACGGGTTCGATACGGAAATGAAGAAGGCGATTGAGACAGGAAGTCTGGATGAGGTCAACAAGATGCTGGGG
CAGATGGCGGTGCCAGAGGCGGAGAAGATGGTCAGCTTGTTTGGAGAGGCAAACGTGCTGAGTCTTGTGGAGCGC
ATTTATGATGCTACGACGGAAGAGGGCAAACAGGAGTTGGCGGCAATGAAAGCGCAGGCAGCAGCAGAGACGGAG
GGGGACCAAGACAAAGGCAAAGGGCCTGCATAA
Gene >OphauG2|4287
ATGCCTGTCGACTACAGTAAATGGGTGTGTTGGAGTCCACTATGCACGATTTTGAAGGTGGTTGCTGACAAGAAA
TACAGGATGCGCTGGAGCTGAGCGACGACTCGGACATTGAGGTGCACCCCAACGTAGACAAAAAGTCGTTTATCC
GTGCCAAGCGACAGCAGATTCATCAGGAGCGTCATCACCGGAAACTTCAAATTGAGACGTTCAAGTATGAAGGCA
TCATCAACAATGGATTGTTGAAGCGCATCTCAGCCCTGTTAGCTTCTCTCAAGGCGCACAGTTCCGAGACAGCGA
CGCGCAAGCCAGCTGAGATTGCCTTTCAGGCCATGATGGAGTCGGCGGGTGATGCAAAGGACGACCAGCCGCCCC
CACCGCCTGAGGGTGTACATAGCGAAGAGAAGGAACAGCCAAGCTATTCCAAGATGATGGCGGTGTTACTCGACC
AGGTCAACAAGGCACTGGACGAGAAAAATCCCAGCGATAGATACAGCGCCATGGTGGCCGAAATCGAGGAGCACG
AGACCAAGATCAAGAAGCTACAAAGGGAGCTAGTGGTAAAGCTTGACGAGATGGAAAAGGAAGACAAAAAGAAGA
TTACGAGCCAAGACATACACACAGGGTTCGATAGTTCTCATGTCAGCAAGTCGAAGCCGTCAGATGCCAAGAAGG
AATCGACACAGGTCGAGCTGCTAAACCCCGGGGCCGGGGCGTCGCTGTCCAAGTCTGAGTCATGCTCATCGTTGG
CAGCGAAAGACGACGTAGCCGTCAAGGACGAGGAGGTGGAGGCTTCGGCGGATGCCAAGAAGTTTGCACGGATCA
GGGCCGACGACTTTACGAGCAGTCTTCAGTTCTTGTCGCAGCACCCGCACATCCTTACGGAGCGCGATTCGGATG
GACTGTTGGTCATGGCATTTGACGCTGCACTCGAGGGCAAGGACGAGGTATCGCGACAGTGTGTGCACCAGGCGT
TGCTACTGCAGTATTGCCGGGCCTTGGGCAGAGACGGGGTGGGGCTATTTTTCAAGCGCATCATGACCAAGGGCC
ACCAGGCAAGGGACGTCTTTTTCAAGGACGTGCAAGACACGTATTTCAGAATCCGGACGCGGTCACGGGAAATAT
TGGCGGAGCGGGCTCGAGACGAAGGAGTAGAGCAGATTCAGCTGCAGGCGGTTGAGCCGGGAACTGAAATTCACA
TCAGGGTGCCGGTAGCGGACAGCAACGACGCAGAAGAGCAAAAGGCGCGGCAGGTGTTTGACGGGTTCGATACGG
AAATGAAGAAGGCGATTGAGACAGGAAGTCTGGATGAGGTCAACAAGATGCTGGGGCAGATGGCGGTGCCAGAGG
CGGAGAAGATGGTCAGCTTGTTTGGAGAGGCAAGTGACGGGCGGCGCCAATGCATGTGGAGCAGAGATTGGGGAC
TAACAAGAGGCTGGCATCTAGGCAAACGTGCTGAGTCTTGTGGAGCGCATTTATGATGCTACGACGGAAGAGGGC
AAACAGGAGTTGGCGGCAATGAAAGCGCAGGCAGCAGCAGAGACGGAGGGGGACCAAGACAAAGGCAAAGGGCCT
GCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail