Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4284
Gene name
LocationContig_352:10602..10956
Strand+
Gene length (bp)354
Transcript length (bp)354
Coding sequence length (bp)354
Protein length (aa) 118

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 9.1E-15 20 99

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 12 108 3.0E-12
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 12 108 7.0E-11
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 12 108 7.0E-11
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 7 106 7.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5696
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4284 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1233
Ophiocordyceps camponoti-floridani Ophcf2|02775
Ophiocordyceps kimflemingae Ophio5|2235
Ophiocordyceps subramaniannii Hirsu2|8674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4284
MPHPTAVFSFVVQPDHCNRMGNLHGGAAASLFDFCTTLPLALVSRPGFWQLMGVTRSLNVTYLRPAPCGEEFLIE
CRIVQIGRRLTTLHGVMKRRKDGQLVSMCEHGKVNNDPEPSL*
Coding >OphauG2|4284
ATGCCCCATCCAACCGCCGTCTTCTCCTTTGTCGTTCAGCCCGACCACTGCAACCGCATGGGCAACCTCCATGGC
GGCGCTGCTGCATCGCTCTTTGACTTTTGCACCACGCTTCCCCTTGCCCTTGTTTCTCGCCCGGGCTTCTGGCAG
TTGATGGGAGTCACTCGCTCCCTCAACGTCACCTACCTGCGCCCTGCGCCCTGCGGAGAAGAATTTCTCATCGAA
TGCCGCATTGTGCAAATTGGGCGGCGCCTCACCACCTTGCACGGTGTTATGAAGAGAAGGAAGGACGGCCAACTC
GTCTCCATGTGCGAGCACGGAAAAGTCAACAATGATCCAGAGCCCAGCCTTTAA
Transcript >OphauG2|4284
ATGCCCCATCCAACCGCCGTCTTCTCCTTTGTCGTTCAGCCCGACCACTGCAACCGCATGGGCAACCTCCATGGC
GGCGCTGCTGCATCGCTCTTTGACTTTTGCACCACGCTTCCCCTTGCCCTTGTTTCTCGCCCGGGCTTCTGGCAG
TTGATGGGAGTCACTCGCTCCCTCAACGTCACCTACCTGCGCCCTGCGCCCTGCGGAGAAGAATTTCTCATCGAA
TGCCGCATTGTGCAAATTGGGCGGCGCCTCACCACCTTGCACGGTGTTATGAAGAGAAGGAAGGACGGCCAACTC
GTCTCCATGTGCGAGCACGGAAAAGTCAACAATGATCCAGAGCCCAGCCTTTAA
Gene >OphauG2|4284
ATGCCCCATCCAACCGCCGTCTTCTCCTTTGTCGTTCAGCCCGACCACTGCAACCGCATGGGCAACCTCCATGGC
GGCGCTGCTGCATCGCTCTTTGACTTTTGCACCACGCTTCCCCTTGCCCTTGTTTCTCGCCCGGGCTTCTGGCAG
TTGATGGGAGTCACTCGCTCCCTCAACGTCACCTACCTGCGCCCTGCGCCCTGCGGAGAAGAATTTCTCATCGAA
TGCCGCATTGTGCAAATTGGGCGGCGCCTCACCACCTTGCACGGTGTTATGAAGAGAAGGAAGGACGGCCAACTC
GTCTCCATGTGCGAGCACGGAAAAGTCAACAATGATCCAGAGCCCAGCCTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail