Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4278
Gene name
LocationContig_351:2765..3622
Strand-
Gene length (bp)857
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup358
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4278 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|4279
Ophiocordyceps australis map64 (Brazil) OphauB2|5376
Ophiocordyceps camponoti-floridani Ophcf2|01325
Ophiocordyceps camponoti-rufipedis Ophun1|6954
Ophiocordyceps kimflemingae Ophio5|1454
Ophiocordyceps subramaniannii Hirsu2|6933
Ophiocordyceps subramaniannii Hirsu2|8900
Ophiocordyceps subramaniannii Hirsu2|8902
Ophiocordyceps subramaniannii Hirsu2|971

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4278
MCERQDENKAELEEGRNGNEGQETRDGNEGDGSRDGNEGQEATSGYTSLTTHHALANLASLSTTASTHGTSLHAL
ILASCTTSLRALFPALSLVGVYLADPSPTPYPTLALVPIKLPPPCRAATLLTTARALQADIAALDASARRVSLAE
LHTWTRASVQVFVNVVVVRPSEGFLLPADRGPESNEGQTTTTNHDLLAHEWVVKNVARHAYPPMVDVEVAVHGND
LTIGVFAPRERLGGDGAQRLVEGVVSCLTGIQDEV*
Coding >OphauG2|4278
ATGTGTGAGAGGCAAGACGAGAACAAGGCCGAGTTGGAGGAGGGGAGAAATGGCAACGAGGGCCAAGAGACGAGA
GACGGGAATGAGGGAGATGGATCGAGGGATGGCAACGAGGGACAAGAGGCGACAAGTGGCTACACCTCCCTCACC
ACCCACCACGCCCTCGCCAACCTCGCCTCCCTCTCCACCACGGCCTCTACCCACGGCACCAGCCTCCACGCCCTC
ATCCTCGCCTCGTGCACCACCTCTCTCCGCGCCCTCTTCCCCGCCCTCTCCCTCGTCGGCGTCTACCTCGCCGAC
CCGTCCCCCACGCCCTACCCAACCCTCGCCCTCGTGCCCATCAAGCTGCCCCCGCCATGCCGCGCCGCCACCCTC
TTGACCACTGCGCGCGCGCTCCAAGCAGACATTGCCGCCCTGGATGCCTCTGCGCGCCGCGTCTCCCTCGCGGAG
CTGCACACGTGGACACGTGCCAGCGTGCAAGTCTTTGTCAATGTCGTCGTCGTGCGGCCCAGCGAGGGCTTTTTG
CTCCCCGCGGACCGTGGGCCAGAGTCCAACGAGGGCCAGACGACGACGACTAATCATGACTTGTTAGCCCATGAG
TGGGTGGTGAAGAATGTTGCCAGACATGCATATCCGCCCATGGTGGATGTTGAAGTGGCAGTCCATGGCAACGAC
TTGACCATTGGTGTCTTTGCGCCCAGGGAGCGGCTTGGTGGTGACGGGGCACAACGCTTGGTCGAGGGCGTCGTG
TCGTGCTTGACGGGTATACAAGACGAGGTTTAG
Transcript >OphauG2|4278
ATGTGTGAGAGGCAAGACGAGAACAAGGCCGAGTTGGAGGAGGGGAGAAATGGCAACGAGGGCCAAGAGACGAGA
GACGGGAATGAGGGAGATGGATCGAGGGATGGCAACGAGGGACAAGAGGCGACAAGTGGCTACACCTCCCTCACC
ACCCACCACGCCCTCGCCAACCTCGCCTCCCTCTCCACCACGGCCTCTACCCACGGCACCAGCCTCCACGCCCTC
ATCCTCGCCTCGTGCACCACCTCTCTCCGCGCCCTCTTCCCCGCCCTCTCCCTCGTCGGCGTCTACCTCGCCGAC
CCGTCCCCCACGCCCTACCCAACCCTCGCCCTCGTGCCCATCAAGCTGCCCCCGCCATGCCGCGCCGCCACCCTC
TTGACCACTGCGCGCGCGCTCCAAGCAGACATTGCCGCCCTGGATGCCTCTGCGCGCCGCGTCTCCCTCGCGGAG
CTGCACACGTGGACACGTGCCAGCGTGCAAGTCTTTGTCAATGTCGTCGTCGTGCGGCCCAGCGAGGGCTTTTTG
CTCCCCGCGGACCGTGGGCCAGAGTCCAACGAGGGCCAGACGACGACGACTAATCATGACTTGTTAGCCCATGAG
TGGGTGGTGAAGAATGTTGCCAGACATGCATATCCGCCCATGGTGGATGTTGAAGTGGCAGTCCATGGCAACGAC
TTGACCATTGGTGTCTTTGCGCCCAGGGAGCGGCTTGGTGGTGACGGGGCACAACGCTTGGTCGAGGGCGTCGTG
TCGTGCTTGACGGGTATACAAGACGAGGTTTAG
Gene >OphauG2|4278
ATGTGTGAGAGGCAAGACGAGAACAAGGCCGAGTTGGAGGAGGGGAGAAATGGCAACGAGGGCCAAGAGACGAGA
GACGGGAATGAGGGAGATGGATCGAGGGATGGCAACGAGGGACAAGAGGCGACAAGTGGCTACACCTCCCTCACC
ACCCACCACGCCCTCGCCAACCTCGCCTCCCTCTCCACCACGGCCTCTACCCACGGCACCAGCCTCCACGCCCTC
ATCCTCGCCTCGTGCACCACCTCTCTCCGCGCCCTCTTCCCCGCCCTCTCCCTCGTCGGCGTCTACCTCGCCGAC
CCGTCCCCCACGCCCTACCCAACCCTCGCCCTCGTGCCCATCAAGCTGCCCCCGCCATGCCGCGCCGCCACCCTC
TTGACCACTGCGCGCGCGCTCCAAGCAGACATTGCCGCCCTGGATGCCTCTGCGCGCCGCGTCTCCCTCGCGGAG
CTGCACACGTGGACACGTGCCAGCGTGCAAGTCTTTGTCAATGTCGTCGTCGTGCGGCCCAGCGAGGGCTTTTTG
CTCCCCGCGGACCGTGGGCCAGAGTCCAACGAGGGCCAGACGACGACGACTAATCATGACTTGTTAGCCCATGAG
TGGGTGGTGAAGAATGTTGCCAGACATGCATATCCGGTAAGTCTTTGAAATCCAGGTCATGGCGGCGTATGGATT
GGGTTTTTCTTGTTGCTAATAATGAAAAAAAAAAGCCCATGGTGGATGTTGAAGTGGCAGTCCATGGCAACGACT
TGACCATTGGTGTCTTTGCGCCCAGGGAGCGGCTTGGTGGTGACGGGGCACAACGCTTGGTCGAGGGCGTCGTGT
CGTGCTTGACGGGTATACAAGACGAGGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail