Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|427
Gene name
LocationContig_11:1787..4609
Strand-
Gene length (bp)2822
Transcript length (bp)2760
Coding sequence length (bp)2760
Protein length (aa) 920

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09949 APP1_cat Phosphatidate phosphatase APP1, catalytic domain 3.2E-46 451 599

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HGP1|YNK4_SCHPO Uncharacterized protein C29B5.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29B5.04c PE=4 SV=1 229 600 5.0E-43
sp|P53933|APP1_YEAST Phosphatidate phosphatase APP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APP1 PE=1 SV=1 409 598 4.0E-39

GO

GO Term Description Terminal node
GO:0008195 phosphatidate phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|427
MWPWGHGRHRDKLARFFFKTLLPRAVHDRYRERLIRFHLNTLPRIKHGIQSRIYRFILERQGKRKGVRGTRLVDL
VARYRRHELPAASRNKSLASPRKDKSMSTSGYLAEPEANATREYGRRRRLAAMAGSLYRSGQQAVTEIRESYAQV
RAKGPSDSASGHGMVHIPGAFPDVAIAWHNEEQMILFPSYAKRHVKAKIEDEQPLKNGVRDEEYWHREWEKAEDE
KAIVDVNVHGWVYSSPTLPLSRRNRMLIGLARQLSGIAVPRWDSVAAGASNGQMQSNHQINEAVTDQQRIAREAA
RIEEKGQEEKRVAYRGGYSEQPTNGGASRVDSLARDHGQPAHAVSAPSSPVLAPKTSQSSTDLSEAELAAANSNL
IARIAPFMTSPLIGQPMTVFFYNDRQSQSRTVETNDAGHFVMQAALDFVPTHMRVLANEQLSASQQVSMVEPSGV
SLISDVDDTVKHSNISAGAREIFRNTFVRELDDLMVEGVREWYGLLQKLGVGFHYCSNSPWQLFPVLSTFFSTCG
LPPGSLHLKQYSGMLQGIFEPVAERKRSTLDRLMRDFPERKFLLVGDSGEADLEVYTELALANPGRVLAIFIRDV
TTPEKVGYFDSSFELSQRRMAAMTVDDEWSPKKTLHNKTSVSSLVIEHKQSSSEPLMGPLIDLAEESDKTKLDDA
AALEQLKKTAGIKTSDASAPITRKVPPLRPVKPAALRSLQEPLKGTQDLSEKATRNAVGEKRPPLPERRSNMEML
APVPTRPVEAGFHGPFQAENAPRKGMDPPPPPPPPRRRMARKPSPRPLDRERGDNNGVDVEPTWKTLTKSASRSS
LRGRNTSPARSEAGAGRKYSRSGTCTPPRGPSSPALTPQGGNKKLEVWRRRLLRAQEQLDGQGVALYTWRRGQDV
VEEAAAIVQDELQAQGQGN*
Coding >OphauG2|427
ATGTGGCCGTGGGGACACGGTCGACATCGCGACAAGCTGGCTCGCTTCTTCTTCAAGACGCTTCTTCCGCGCGCC
GTGCACGATCGGTATCGCGAGCGGCTGATTCGCTTTCATCTCAACACGCTGCCCCGGATCAAACACGGCATTCAG
TCGCGCATCTATCGCTTTATCCTCGAGCGCCAGGGCAAACGCAAAGGCGTGCGCGGGACACGGCTTGTCGATCTT
GTCGCCCGATACAGGCGGCACGAGCTGCCGGCAGCAAGTCGCAACAAGAGCCTGGCGTCACCTCGCAAAGACAAA
AGCATGTCGACTTCGGGATACCTTGCCGAGCCAGAAGCGAATGCCACACGCGAATATGGACGAAGACGCAGGCTT
GCCGCAATGGCGGGCAGCCTCTACCGCAGCGGCCAACAGGCCGTGACAGAGATTCGAGAGTCGTATGCCCAGGTG
AGAGCCAAAGGCCCCAGCGATTCCGCGTCGGGGCATGGCATGGTGCATATTCCAGGTGCCTTTCCCGATGTGGCC
ATTGCCTGGCACAACGAGGAACAAATGATTCTCTTTCCATCCTACGCCAAGCGCCATGTCAAGGCCAAGATTGAA
GACGAGCAACCTCTCAAGAACGGTGTCCGCGACGAGGAATACTGGCACCGCGAATGGGAAAAGGCCGAGGACGAA
AAAGCCATTGTCGATGTCAATGTCCACGGATGGGTTTATTCGTCGCCCACGCTCCCCCTTAGCCGACGCAACCGG
ATGCTGATTGGCTTGGCTCGACAGCTGAGCGGCATCGCCGTACCAAGATGGGATTCTGTGGCGGCTGGGGCTAGC
AATGGACAGATGCAAAGCAACCACCAGATCAATGAGGCCGTGACGGACCAACAGAGAATAGCCCGGGAGGCGGCA
CGGATAGAGGAGAAGGGCCAGGAGGAGAAGCGTGTGGCGTACAGAGGCGGCTACAGCGAACAGCCCACTAATGGG
GGAGCCAGCAGAGTCGACAGTCTAGCTCGCGACCATGGACAGCCGGCCCATGCCGTTTCAGCACCATCAAGTCCC
GTACTGGCGCCAAAGACGTCACAAAGCTCGACGGACCTGAGCGAGGCAGAGCTGGCGGCAGCAAACTCCAATCTC
ATAGCTCGCATCGCGCCGTTTATGACGAGTCCCCTCATCGGGCAGCCCATGACGGTATTTTTCTACAACGACAGA
CAGTCGCAGTCGCGGACCGTGGAGACAAACGACGCAGGCCACTTTGTGATGCAGGCTGCGCTTGACTTTGTGCCG
ACGCACATGCGCGTGCTGGCCAACGAGCAACTGTCAGCGTCGCAACAAGTGTCCATGGTTGAGCCTAGCGGGGTG
AGTCTGATTAGCGACGTGGATGACACGGTCAAGCACTCCAATATATCCGCTGGTGCTCGTGAAATCTTTCGCAAC
ACCTTTGTGCGTGAGCTGGACGACTTGATGGTTGAGGGCGTGCGCGAGTGGTACGGGCTGCTCCAGAAACTGGGT
GTTGGATTCCACTATTGCTCCAACAGCCCGTGGCAGCTTTTTCCTGTGCTGTCCACCTTTTTCAGCACGTGTGGG
CTTCCCCCAGGATCGCTGCATCTGAAGCAATACTCGGGCATGCTGCAAGGCATCTTTGAGCCAGTAGCTGAGCGG
AAGCGATCGACGCTGGACCGCCTGATGCGAGACTTTCCTGAGCGCAAGTTTTTGCTGGTGGGCGACAGCGGCGAG
GCAGATCTCGAGGTTTACACGGAGCTGGCGCTGGCAAACCCGGGCAGGGTGCTGGCAATCTTTATCCGGGATGTG
ACGACGCCGGAAAAGGTGGGATACTTTGACTCGTCTTTTGAGCTGTCGCAGCGCAGAATGGCAGCCATGACGGTT
GATGACGAATGGTCGCCCAAGAAAACACTACACAACAAGACTAGCGTGTCGAGCCTTGTGATTGAGCACAAGCAA
TCTTCCTCGGAGCCCCTGATGGGCCCGCTTATTGACCTTGCTGAAGAGTCGGACAAGACCAAGCTTGACGACGCT
GCTGCGCTGGAGCAGTTGAAGAAGACGGCGGGGATCAAGACGTCTGACGCATCGGCCCCAATTACACGAAAAGTA
CCACCTCTGCGTCCAGTGAAGCCAGCTGCGTTACGGAGTCTTCAGGAGCCTCTCAAGGGGACACAGGACCTGAGT
GAGAAGGCTACGCGCAATGCAGTCGGCGAGAAGCGGCCACCACTGCCAGAGAGGAGAAGTAATATGGAAATGCTG
GCTCCGGTGCCAACAAGGCCAGTGGAAGCAGGCTTCCATGGTCCATTTCAAGCAGAAAACGCGCCTAGAAAAGGC
ATGGATCCGCCGCCGCCGCCGCCGCCGCCCAGACGGAGAATGGCGAGGAAGCCGAGTCCGCGCCCTCTGGACAGA
GAGCGTGGGGATAATAACGGGGTAGATGTAGAGCCTACGTGGAAGACACTGACCAAGTCTGCGTCGCGGAGTAGT
CTTCGAGGGCGCAATACATCACCAGCACGGAGCGAAGCTGGAGCTGGTAGGAAATACTCTCGCTCTGGGACGTGT
ACGCCGCCGCGAGGGCCAAGCAGCCCGGCTTTGACGCCACAGGGAGGCAACAAGAAGCTCGAGGTGTGGCGGCGA
CGTCTGCTGCGTGCGCAGGAGCAGCTCGACGGGCAAGGAGTGGCGCTTTATACGTGGCGACGGGGACAAGACGTG
GTTGAAGAGGCGGCGGCGATTGTGCAGGACGAGTTGCAGGCGCAAGGGCAAGGGAACTGA
Transcript >OphauG2|427
ATGTGGCCGTGGGGACACGGTCGACATCGCGACAAGCTGGCTCGCTTCTTCTTCAAGACGCTTCTTCCGCGCGCC
GTGCACGATCGGTATCGCGAGCGGCTGATTCGCTTTCATCTCAACACGCTGCCCCGGATCAAACACGGCATTCAG
TCGCGCATCTATCGCTTTATCCTCGAGCGCCAGGGCAAACGCAAAGGCGTGCGCGGGACACGGCTTGTCGATCTT
GTCGCCCGATACAGGCGGCACGAGCTGCCGGCAGCAAGTCGCAACAAGAGCCTGGCGTCACCTCGCAAAGACAAA
AGCATGTCGACTTCGGGATACCTTGCCGAGCCAGAAGCGAATGCCACACGCGAATATGGACGAAGACGCAGGCTT
GCCGCAATGGCGGGCAGCCTCTACCGCAGCGGCCAACAGGCCGTGACAGAGATTCGAGAGTCGTATGCCCAGGTG
AGAGCCAAAGGCCCCAGCGATTCCGCGTCGGGGCATGGCATGGTGCATATTCCAGGTGCCTTTCCCGATGTGGCC
ATTGCCTGGCACAACGAGGAACAAATGATTCTCTTTCCATCCTACGCCAAGCGCCATGTCAAGGCCAAGATTGAA
GACGAGCAACCTCTCAAGAACGGTGTCCGCGACGAGGAATACTGGCACCGCGAATGGGAAAAGGCCGAGGACGAA
AAAGCCATTGTCGATGTCAATGTCCACGGATGGGTTTATTCGTCGCCCACGCTCCCCCTTAGCCGACGCAACCGG
ATGCTGATTGGCTTGGCTCGACAGCTGAGCGGCATCGCCGTACCAAGATGGGATTCTGTGGCGGCTGGGGCTAGC
AATGGACAGATGCAAAGCAACCACCAGATCAATGAGGCCGTGACGGACCAACAGAGAATAGCCCGGGAGGCGGCA
CGGATAGAGGAGAAGGGCCAGGAGGAGAAGCGTGTGGCGTACAGAGGCGGCTACAGCGAACAGCCCACTAATGGG
GGAGCCAGCAGAGTCGACAGTCTAGCTCGCGACCATGGACAGCCGGCCCATGCCGTTTCAGCACCATCAAGTCCC
GTACTGGCGCCAAAGACGTCACAAAGCTCGACGGACCTGAGCGAGGCAGAGCTGGCGGCAGCAAACTCCAATCTC
ATAGCTCGCATCGCGCCGTTTATGACGAGTCCCCTCATCGGGCAGCCCATGACGGTATTTTTCTACAACGACAGA
CAGTCGCAGTCGCGGACCGTGGAGACAAACGACGCAGGCCACTTTGTGATGCAGGCTGCGCTTGACTTTGTGCCG
ACGCACATGCGCGTGCTGGCCAACGAGCAACTGTCAGCGTCGCAACAAGTGTCCATGGTTGAGCCTAGCGGGGTG
AGTCTGATTAGCGACGTGGATGACACGGTCAAGCACTCCAATATATCCGCTGGTGCTCGTGAAATCTTTCGCAAC
ACCTTTGTGCGTGAGCTGGACGACTTGATGGTTGAGGGCGTGCGCGAGTGGTACGGGCTGCTCCAGAAACTGGGT
GTTGGATTCCACTATTGCTCCAACAGCCCGTGGCAGCTTTTTCCTGTGCTGTCCACCTTTTTCAGCACGTGTGGG
CTTCCCCCAGGATCGCTGCATCTGAAGCAATACTCGGGCATGCTGCAAGGCATCTTTGAGCCAGTAGCTGAGCGG
AAGCGATCGACGCTGGACCGCCTGATGCGAGACTTTCCTGAGCGCAAGTTTTTGCTGGTGGGCGACAGCGGCGAG
GCAGATCTCGAGGTTTACACGGAGCTGGCGCTGGCAAACCCGGGCAGGGTGCTGGCAATCTTTATCCGGGATGTG
ACGACGCCGGAAAAGGTGGGATACTTTGACTCGTCTTTTGAGCTGTCGCAGCGCAGAATGGCAGCCATGACGGTT
GATGACGAATGGTCGCCCAAGAAAACACTACACAACAAGACTAGCGTGTCGAGCCTTGTGATTGAGCACAAGCAA
TCTTCCTCGGAGCCCCTGATGGGCCCGCTTATTGACCTTGCTGAAGAGTCGGACAAGACCAAGCTTGACGACGCT
GCTGCGCTGGAGCAGTTGAAGAAGACGGCGGGGATCAAGACGTCTGACGCATCGGCCCCAATTACACGAAAAGTA
CCACCTCTGCGTCCAGTGAAGCCAGCTGCGTTACGGAGTCTTCAGGAGCCTCTCAAGGGGACACAGGACCTGAGT
GAGAAGGCTACGCGCAATGCAGTCGGCGAGAAGCGGCCACCACTGCCAGAGAGGAGAAGTAATATGGAAATGCTG
GCTCCGGTGCCAACAAGGCCAGTGGAAGCAGGCTTCCATGGTCCATTTCAAGCAGAAAACGCGCCTAGAAAAGGC
ATGGATCCGCCGCCGCCGCCGCCGCCGCCCAGACGGAGAATGGCGAGGAAGCCGAGTCCGCGCCCTCTGGACAGA
GAGCGTGGGGATAATAACGGGGTAGATGTAGAGCCTACGTGGAAGACACTGACCAAGTCTGCGTCGCGGAGTAGT
CTTCGAGGGCGCAATACATCACCAGCACGGAGCGAAGCTGGAGCTGGTAGGAAATACTCTCGCTCTGGGACGTGT
ACGCCGCCGCGAGGGCCAAGCAGCCCGGCTTTGACGCCACAGGGAGGCAACAAGAAGCTCGAGGTGTGGCGGCGA
CGTCTGCTGCGTGCGCAGGAGCAGCTCGACGGGCAAGGAGTGGCGCTTTATACGTGGCGACGGGGACAAGACGTG
GTTGAAGAGGCGGCGGCGATTGTGCAGGACGAGTTGCAGGCGCAAGGGCAAGGGAACTGA
Gene >OphauG2|427
ATGTGGCCGTGGGGTCTAGGAGGCGAGAGTGACGGATATAAAGCCCTGGAGCATCTGCAGTCTGCGTTGCTCCAG
GACACGGTCGACATCGCGACAAGCTGGCTCGCTTCTTCTTCAAGACGCTTCTTCCGCGCGCCGTGCACGATCGGT
ATCGCGAGCGGCTGATTCGCTTTCATCTCAACACGCTGCCCCGGATCAAACACGGCATTCAGTCGCGCATCTATC
GCTTTATCCTCGAGCGCCAGGGCAAACGCAAAGGCGTGCGCGGGACACGGCTTGTCGATCTTGTCGCCCGATACA
GGCGGCACGAGCTGCCGGCAGCAAGTCGCAACAAGAGCCTGGCGTCACCTCGCAAAGACAAAAGCATGTCGACTT
CGGGATACCTTGCCGAGCCAGAAGCGAATGCCACACGCGAATATGGACGAAGACGCAGGCTTGCCGCAATGGCGG
GCAGCCTCTACCGCAGCGGCCAACAGGCCGTGACAGAGATTCGAGAGTCGTATGCCCAGGTGAGAGCCAAAGGCC
CCAGCGATTCCGCGTCGGGGCATGGCATGGTGCATATTCCAGGTGCCTTTCCCGATGTGGCCATTGCCTGGCACA
ACGAGGAACAAATGATTCTCTTTCCATCCTACGCCAAGCGCCATGTCAAGGCCAAGATTGAAGACGAGCAACCTC
TCAAGAACGGTGTCCGCGACGAGGAATACTGGCACCGCGAATGGGAAAAGGCCGAGGACGAAAAAGCCATTGTCG
ATGTCAATGTCCACGGATGGGTTTATTCGTCGCCCACGCTCCCCCTTAGCCGACGCAACCGGATGCTGATTGGCT
TGGCTCGACAGCTGAGCGGCATCGCCGTACCAAGATGGGATTCTGTGGCGGCTGGGGCTAGCAATGGACAGATGC
AAAGCAACCACCAGATCAATGAGGCCGTGACGGACCAACAGAGAATAGCCCGGGAGGCGGCACGGATAGAGGAGA
AGGGCCAGGAGGAGAAGCGTGTGGCGTACAGAGGCGGCTACAGCGAACAGCCCACTAATGGGGGAGCCAGCAGAG
TCGACAGTCTAGCTCGCGACCATGGACAGCCGGCCCATGCCGTTTCAGCACCATCAAGTCCCGTACTGGCGCCAA
AGACGTCACAAAGCTCGACGGACCTGAGCGAGGCAGAGCTGGCGGCAGCAAACTCCAATCTCATAGCTCGCATCG
CGCCGTTTATGACGAGTCCCCTCATCGGGCAGCCCATGACGGTATTTTTCTACAACGACAGACAGTCGCAGTCGC
GGACCGTGGAGACAAACGACGCAGGCCACTTTGTGATGCAGGCTGCGCTTGACTTTGTGCCGACGCACATGCGCG
TGCTGGCCAACGAGCAACTGTCAGCGTCGCAACAAGTGTCCATGGTTGAGCCTAGCGGGGTGAGTCTGATTAGCG
ACGTGGATGACACGGTCAAGCACTCCAATATATCCGCTGGTGCTCGTGAAATCTTTCGCAACACCTTTGTGCGTG
AGCTGGACGACTTGATGGTTGAGGGCGTGCGCGAGTGGTACGGGCTGCTCCAGAAACTGGGTGTTGGATTCCACT
ATTGCTCCAACAGCCCGTGGCAGCTTTTTCCTGTGCTGTCCACCTTTTTCAGCACGTGTGGGCTTCCCCCAGGAT
CGCTGCATCTGAAGCAATACTCGGGCATGCTGCAAGGCATCTTTGAGCCAGTAGCTGAGCGGAAGCGATCGACGC
TGGACCGCCTGATGCGAGACTTTCCTGAGCGCAAGTTTTTGCTGGTGGGCGACAGCGGCGAGGCAGATCTCGAGG
TTTACACGGAGCTGGCGCTGGCAAACCCGGGCAGGGTGCTGGCAATCTTTATCCGGGATGTGACGACGCCGGAAA
AGGTGGGATACTTTGACTCGTCTTTTGAGCTGTCGCAGCGCAGAATGGCAGCCATGACGGTTGATGACGAATGGT
CGCCCAAGAAAACACTACACAACAAGACTAGCGTGTCGAGCCTTGTGATTGAGCACAAGCAATCTTCCTCGGAGC
CCCTGATGGGCCCGCTTATTGACCTTGCTGAAGAGTCGGACAAGACCAAGCTTGACGACGCTGCTGCGCTGGAGC
AGTTGAAGAAGACGGCGGGGATCAAGACGTCTGACGCATCGGCCCCAATTACACGAAAAGTACCACCTCTGCGTC
CAGTGAAGCCAGCTGCGTTACGGAGTCTTCAGGAGCCTCTCAAGGGGACACAGGACCTGAGTGAGAAGGCTACGC
GCAATGCAGTCGGCGAGAAGCGGCCACCACTGCCAGAGAGGAGAAGTAATATGGAAATGCTGGCTCCGGTGCCAA
CAAGGCCAGTGGAAGCAGGCTTCCATGGTCCATTTCAAGCAGAAAACGCGCCTAGAAAAGGCATGGATCCGCCGC
CGCCGCCGCCGCCGCCCAGACGGAGAATGGCGAGGAAGCCGAGTCCGCGCCCTCTGGACAGAGAGCGTGGGGATA
ATAACGGGGTAGATGTAGAGCCTACGTGGAAGACACTGACCAAGTCTGCGTCGCGGAGTAGTCTTCGAGGGCGCA
ATACATCACCAGCACGGAGCGAAGCTGGAGCTGGTAGGAAATACTCTCGCTCTGGGACGTGTACGCCGCCGCGAG
GGCCAAGCAGCCCGGCTTTGACGCCACAGGGAGGCAACAAGAAGCTCGAGGTGTGGCGGCGACGTCTGCTGCGTG
CGCAGGAGCAGCTCGACGGGCAAGGAGTGGCGCTTTATACGTGGCGACGGGGACAAGACGTGGTTGAAGAGGCGG
CGGCGATTGTGCAGGACGAGTTGCAGGCGCAAGGGCAAGGGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail