Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|426
Gene name
LocationContig_11:792..1566
Strand+
Gene length (bp)774
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 177 199 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3436
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|426 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|219
Ophiocordyceps camponoti-floridani Ophcf2|04960
Ophiocordyceps camponoti-rufipedis Ophun1|5589
Ophiocordyceps kimflemingae Ophio5|6108
Ophiocordyceps subramaniannii Hirsu2|6532

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|426
MEHPVREIAGVIKLLTTGTPTEQEDVLNTYFLPGVSFEHPICRIPSIPPDLFPYSLLGIDSRWLLLGIYRWYRTI
SPRVDIGIDSAIFDQRSGQLFVDIHQTLSFWFIPFHKARVNLVTVLLLQQGSAPAAHNSTALSGTGHERSRYYIA
SQKDYYSFKEFATFAFPVIGPLIMVLIQLYTSTVCILGSILLFPLYLLLNAGTPPVKQHSQ*
Coding >OphauG2|426
ATGGAGCATCCCGTCCGTGAAATCGCCGGAGTCATCAAGCTGCTCACCACTGGTACCCCCACGGAGCAGGAAGAC
GTGCTCAACACCTACTTCCTCCCCGGCGTCTCGTTTGAGCATCCCATTTGCAGAATCCCCTCGATACCCCCCGAC
CTCTTCCCCTACTCGCTCTTGGGCATCGACTCGCGATGGCTTCTCCTCGGCATATACCGCTGGTATCGAACAATC
AGCCCTCGCGTCGACATTGGCATCGACTCTGCCATCTTTGACCAGCGCTCAGGCCAGCTCTTTGTTGATATCCAC
CAGACCCTGTCCTTTTGGTTCATTCCCTTCCACAAGGCCCGTGTCAACCTCGTCACCGTCTTGCTCCTCCAGCAA
GGCTCTGCCCCCGCTGCCCACAACTCCACCGCTCTTTCTGGCACCGGCCACGAGCGATCCCGCTACTACATTGCC
TCCCAAAAGGACTACTACTCCTTCAAAGAATTTGCCACCTTTGCCTTCCCAGTCATCGGTCCCCTCATCATGGTG
CTCATTCAGCTCTACACCTCTACTGTGTGCATCCTGGGCTCCATCCTCCTCTTCCCTCTCTACCTGCTGCTGAAT
GCCGGCACGCCCCCGGTCAAGCAACATTCACAGTAA
Transcript >OphauG2|426
ATGGAGCATCCCGTCCGTGAAATCGCCGGAGTCATCAAGCTGCTCACCACTGGTACCCCCACGGAGCAGGAAGAC
GTGCTCAACACCTACTTCCTCCCCGGCGTCTCGTTTGAGCATCCCATTTGCAGAATCCCCTCGATACCCCCCGAC
CTCTTCCCCTACTCGCTCTTGGGCATCGACTCGCGATGGCTTCTCCTCGGCATATACCGCTGGTATCGAACAATC
AGCCCTCGCGTCGACATTGGCATCGACTCTGCCATCTTTGACCAGCGCTCAGGCCAGCTCTTTGTTGATATCCAC
CAGACCCTGTCCTTTTGGTTCATTCCCTTCCACAAGGCCCGTGTCAACCTCGTCACCGTCTTGCTCCTCCAGCAA
GGCTCTGCCCCCGCTGCCCACAACTCCACCGCTCTTTCTGGCACCGGCCACGAGCGATCCCGCTACTACATTGCC
TCCCAAAAGGACTACTACTCCTTCAAAGAATTTGCCACCTTTGCCTTCCCAGTCATCGGTCCCCTCATCATGGTG
CTCATTCAGCTCTACACCTCTACTGTGTGCATCCTGGGCTCCATCCTCCTCTTCCCTCTCTACCTGCTGCTGAAT
GCCGGCACGCCCCCGGTCAAGCAACATTCACAGTAA
Gene >OphauG2|426
ATGGAGCATCCCGGTGTGTTGCAAAACAACATCAAGAAAAAAAATACCCATCCCATGCCAATTCGCTCTCCGGCA
ATGCTAACCCTCCTCTTCAGTCCGTGAAATCGCCGGAGTCATCAAGCTGCTCACCACTGGTACCCCCACGGAGCA
GGAAGACGTGCTCAACACCTACTTCCTCCCCGGCGTCTCGTTTGAGCATCCCATTTGCAGAATCCCCTCGATACC
CCCCGACCTCTTCCCCTACTCGCTCTTGGGCATCGACTCGCGATGGCTTCTCCTCGGCATATACCGCTGGTATCG
AACAATCAGCCCTCGCGTCGACATTGGCATCGACTCTGCCAGCAAGTCATGCTCCAGTCCACTCTCTCCTCCCCA
CATTGCACTAACTCCTCCCCAGTCTTTGACCAGCGCTCAGGCCAGCTCTTTGTTGATATCCACCAGACCCTGTCC
TTTTGGTTCATTCCCTTCCACAAGGCCCGTGTCAACCTCGTCACCGTCTTGCTCCTCCAGCAAGGCTCTGCCCCC
GCTGCCCACAACTCCACCGCTCTTTCTGGCACCGGCCACGAGCGATCCCGCTACTACATTGCCTCCCAAAAGGAC
TACTACTCCTTCAAAGAATTTGCCACCTTTGCCTTCCCAGTCATCGGTCCCCTCATCATGGTGCTCATTCAGCTC
TACACCTCTACTGTGTGCATCCTGGGCTCCATCCTCCTCTTCCCTCTCTACCTGCTGCTGAATGCCGGCACGCCC
CCGGTCAAGCAACATTCACAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail