Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4248
Gene name
LocationContig_35:30..842
Strand-
Gene length (bp)812
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.7E-19 5 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09676|YA03_SCHPO Probable phosphatase SPAC5H10.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5H10.03 PE=3 SV=1 1 195 1.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8089
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4248 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|940

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4248
MAPTIHLVRHAQGVHNLSVANESIHDPDVTALGQEQCAALGAAFPYHASLKHLVASPLRRTITTCLAAFGHGNVG
PVVALDVLQEVSAAPCDVGSAPEVLQREFGSQVDLAGVRAAWTDKGPGSVFEPTVDKLTARASEARRALRDLVRG
EEHLVAVTHGGFLHFLTDDWQGIPEGRATGWDNCECRSYQFADPTGEDDDALLIETDQSRARRHFGANPLSPQEK
RELRAAVQRRLVPHLKINQSA*
Coding >OphauG2|4248
ATGGCACCAACAATTCATCTGGTGCGCCATGCACAAGGCGTACACAACCTGTCCGTGGCCAACGAGTCGATTCAC
GACCCAGATGTCACAGCACTAGGCCAAGAGCAATGCGCGGCTCTCGGAGCAGCATTCCCCTACCACGCGTCGCTC
AAACACCTCGTCGCGTCGCCGCTTCGGCGCACAATCACCACGTGCCTTGCCGCCTTTGGCCACGGCAATGTCGGG
CCCGTGGTGGCGCTTGACGTGCTTCAAGAAGTGTCGGCCGCGCCGTGTGACGTGGGCTCTGCTCCCGAGGTGCTG
CAGCGCGAGTTTGGCTCCCAGGTGGACCTGGCGGGCGTGCGCGCGGCGTGGACGGACAAAGGACCGGGCAGCGTG
TTTGAGCCGACGGTGGACAAGCTGACGGCCAGGGCAAGCGAGGCGCGCAGGGCGTTGAGGGATTTGGTGCGGGGC
GAGGAGCACCTGGTGGCGGTGACGCATGGAGGGTTTCTGCACTTTTTGACGGATGATTGGCAGGGCATTCCCGAG
GGCAGAGCAACGGGCTGGGATAACTGCGAATGCCGCTCCTACCAGTTCGCCGACCCGACGGGCGAGGACGACGAC
GCGCTTCTGATTGAGACGGACCAGAGCCGTGCCCGTCGCCACTTTGGCGCGAATCCTCTGTCGCCGCAGGAGAAG
CGCGAGCTGCGAGCTGCTGTCCAGCGTCGTTTGGTTCCCCATCTCAAGATTAACCAATCGGCATAA
Transcript >OphauG2|4248
ATGGCACCAACAATTCATCTGGTGCGCCATGCACAAGGCGTACACAACCTGTCCGTGGCCAACGAGTCGATTCAC
GACCCAGATGTCACAGCACTAGGCCAAGAGCAATGCGCGGCTCTCGGAGCAGCATTCCCCTACCACGCGTCGCTC
AAACACCTCGTCGCGTCGCCGCTTCGGCGCACAATCACCACGTGCCTTGCCGCCTTTGGCCACGGCAATGTCGGG
CCCGTGGTGGCGCTTGACGTGCTTCAAGAAGTGTCGGCCGCGCCGTGTGACGTGGGCTCTGCTCCCGAGGTGCTG
CAGCGCGAGTTTGGCTCCCAGGTGGACCTGGCGGGCGTGCGCGCGGCGTGGACGGACAAAGGACCGGGCAGCGTG
TTTGAGCCGACGGTGGACAAGCTGACGGCCAGGGCAAGCGAGGCGCGCAGGGCGTTGAGGGATTTGGTGCGGGGC
GAGGAGCACCTGGTGGCGGTGACGCATGGAGGGTTTCTGCACTTTTTGACGGATGATTGGCAGGGCATTCCCGAG
GGCAGAGCAACGGGCTGGGATAACTGCGAATGCCGCTCCTACCAGTTCGCCGACCCGACGGGCGAGGACGACGAC
GCGCTTCTGATTGAGACGGACCAGAGCCGTGCCCGTCGCCACTTTGGCGCGAATCCTCTGTCGCCGCAGGAGAAG
CGCGAGCTGCGAGCTGCTGTCCAGCGTCGTTTGGTTCCCCATCTCAAGATTAACCAATCGGCATAA
Gene >OphauG2|4248
ATGGCACCAACAATTCATCTGGTGCGCCATGCACAAGGCGTACACAACCTGTCCGTGGCCAACGAGTCGATTCAC
GACCCAGATGTCACAGCACTAGGCCAAGAGCAATGCGCGGCTCTCGGAGCAGCATTCCCCTACCACGCGTCGCTC
AAACACCTCGTCGCGTCGCCGCTTCGGCGCACAATCACCACGTGCCTTGCCGCCTTTGGCCACGGCAATGTCGGG
CCCGTGGTGGCGCTTGACGTGCTTCAAGAAGTGTCGGCCGCGCCGTGTGACGTGGGCTCTGCTCCCGAGGTGCTG
CAGCGCGAGTTTGGCTCCCAGGTGGACCTGGCGGGCGTGCGCGCGGCGTGGACGGACAAAGGACCGGGCAGCGTG
TTTGAGCCGACGGTGGACAAGCTGACGGCCAGGGCAAGCGAGGCGCGCAGGGCGTTGAGGGATTTGGTGCGGGGC
GAGGAGCACCTGGTGGCGGTGACGCATGGAGGGTTTCTGCACTTTTTGACGGATGATTGGCAGGGCATTCCCGAG
GGCAGAGGTAAAACATGCTGCTTGGCCTCTGTACCGAGACAAAGCATGCTGGGCTGACACCTTGCTGACTTGACA
CAGCAACGGGCTGGGATAACTGCGAATGCCGCTCCTACCAGTTCGCCGACCCGACGGGCGAGGACGACGACGCGC
TTCTGATTGAGACGGACCAGAGCCGTGCCCGTCGCCACTTTGGCGCGAATCCTCTGTCGCCGCAGGAGAAGCGCG
AGCTGCGAGCTGCTGTCCAGCGTCGTTTGGTTCCCCATCTCAAGATTAACCAATCGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail