Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4223
Gene name
LocationContig_345:3095..9852
Strand-
Gene length (bp)6757
Transcript length (bp)5640
Coding sequence length (bp)5640
Protein length (aa) 1880

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02889 Sec63 Sec63 Brl domain 2.0E-29 915 998
PF02889 Sec63 Sec63 Brl domain 5.0E-07 1046 1084
PF02889 Sec63 Sec63 Brl domain 5.7E-65 1517 1862
PF18149 Helicase_PWI N-terminal helicase PWI domain 3.7E-32 289 402
PF00270 DEAD DEAD/DEAH box helicase 4.2E-10 572 654

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 1 1877 0.0E+00
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 4 1871 0.0E+00
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 469 1668 0.0E+00
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 462 1658 0.0E+00
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 473 1673 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 1 1877 0.0E+00
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 4 1871 0.0E+00
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 469 1668 0.0E+00
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 462 1658 0.0E+00
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 473 1673 0.0E+00
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 465 1869 0.0E+00
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 470 1692 0.0E+00
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 465 1877 0.0E+00
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 465 1869 0.0E+00
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 465 1859 0.0E+00
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 337 1859 0.0E+00
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 11 1866 0.0E+00
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 1 1864 0.0E+00
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 1 1868 0.0E+00
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 8 1864 0.0E+00
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 2 1864 0.0E+00
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 1 1879 0.0E+00
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 1 1877 0.0E+00
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 473 1869 0.0E+00
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 1 1877 0.0E+00
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 502 998 1.0E-45
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 502 913 2.0E-45
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 502 849 3.0E-43
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 502 998 6.0E-42
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 496 991 1.0E-40
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 1146 1669 7.0E-38
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 493 996 2.0E-36
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 1155 1583 2.0E-33
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 1173 1639 5.0E-30
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 1155 1582 7.0E-30
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 1155 1666 2.0E-29
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 1187 1683 2.0E-23
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 1207 1692 2.0E-23
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 530 862 4.0E-22
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 557 818 3.0E-21
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 546 908 4.0E-21
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 556 943 7.0E-21
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 546 908 2.0E-20
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 557 790 2.0E-20
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 557 818 2.0E-20
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 556 907 2.0E-20
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 546 908 2.0E-20
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 557 819 3.0E-20
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 557 841 3.0E-19
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 557 907 1.0E-18
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 582 823 2.0E-18
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 557 801 1.0E-17
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 521 900 7.0E-17
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 541 907 8.0E-17
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 557 801 1.0E-16
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 576 834 2.0E-16
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 557 839 2.0E-16
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 530 813 2.0E-16
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 553 791 3.0E-16
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 553 801 3.0E-15
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 557 801 5.0E-15
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 559 801 6.0E-15
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 557 778 1.0E-14
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 582 848 1.0E-14
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 582 897 5.0E-14
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 523 802 7.0E-14
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 523 802 7.0E-14
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 557 815 2.0E-13
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 557 908 4.0E-13
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 584 902 5.0E-13
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 608 837 1.0E-12
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 559 782 2.0E-11
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 672 811 1.0E-08
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 668 796 3.0E-08
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 683 817 4.0E-08
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 736 794 9.0E-08
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 727 790 9.0E-08
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 672 811 1.0E-07
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 736 790 2.0E-07
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 677 803 3.0E-07
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 1163 1474 3.0E-07
sp|P95949|HELX_SULSO Uncharacterized ATP-dependent helicase SSO0112 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0112 PE=3 SV=1 581 783 3.0E-07
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 730 792 4.0E-07
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 684 811 4.0E-07
sp|Q8VHE0|SEC63_MOUSE Translocation protein SEC63 homolog OS=Mus musculus GN=Sec63 PE=1 SV=4 1547 1757 6.0E-07
sp|Q5R660|SEC63_PONAB Translocation protein SEC63 homolog OS=Pongo abelii GN=SEC63 PE=2 SV=1 1547 1757 7.0E-07
sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens GN=SEC63 PE=1 SV=2 1547 1757 8.0E-07
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 736 790 1.0E-06
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 1189 1410 2.0E-06
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 1189 1410 2.0E-06
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 523 790 2.0E-06
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 672 803 3.0E-06
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 1191 1465 4.0E-06
sp|Q57742|HELX_METJA Uncharacterized ATP-dependent helicase MJ0294 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0294 PE=3 SV=1 581 790 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup192
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4223 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|5437
Ophiocordyceps australis map64 (Brazil) OphauB2|1852
Ophiocordyceps australis map64 (Brazil) OphauB2|3897
Ophiocordyceps camponoti-floridani Ophcf2|04109
Ophiocordyceps camponoti-floridani Ophcf2|04554
Ophiocordyceps camponoti-rufipedis Ophun1|4478
Ophiocordyceps camponoti-rufipedis Ophun1|5490
Ophiocordyceps kimflemingae Ophio5|8406
Ophiocordyceps kimflemingae Ophio5|858
Ophiocordyceps subramaniannii Hirsu2|6747
Ophiocordyceps subramaniannii Hirsu2|7043

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4223
MSDPHRDVSQYKYSAMSNLVLQADRRFVTRRNDEATGDPESLAGRLSIRDMGGRIARDSAPKPKKQSGLAGIERG
ALGEGQDVLLREQRKRNAEATKSSGVLGANDALIEGITYRPRTAATRATFDLILTSIASYIGDVPHEVVRSAADA
VLEYLKDDDMKEIDKKKEIDDIIGSTLGLKEYNELVNLGKKITDYNAQDDDEADAGDDSGNAEIDERQGVAVTFD
DEENEDEMVQEVHEASSEDEVDEDHYEGQDTDAPETHEVVSDDEDMDHGPKTGHASKSGNAVAEIAARDIDAFWL
QRQIGMLYPDAHEQADKTKAALHILSAEPDEAGDEEKSLREVENELMELFDFEHHELVQRLVENRERVYWLTKLA
RAETAEQRAQVEREIASEGLQGLLTELRGGDANGDADKARMEIKMDIDVPASLVAEKGGDEKAEGYLVGGLQPKK
LINLENLVFDQGNHLMTNQKVRLPEGSTKRTFKGYEEIHVPPPKKRNDAEDALIPISDLPEWCRGPFSTTRSLNK
IQSKCYPSAFEGDGNMLNRDAETGEIDLDAFKIVYIAPLKALVQEQLTKQQIAETQIIVTTPEKWDVVTRKANDL
TYTNLVRLIIIDEIHLLHDERGPVLESIVSRTIRKTEQTGEAVRLVGLSATLPNYRDVASFLREFIGVTDRKAIK
QVKTMNEMLIFVHSRKDTAKTAKYIRDKAVDMETINKILRHDAGSREVLNEAASQATDQDLKDLLPHGFGIHHAG
MNRVDRSDVEDLFARGAIQVLVCTATLAWGVNLPAHTVIIKGTQVYSPEKGSWYDTYGEGIIITTQSEMQYYLSL
LNQQLPIESQFASKLVDNLNAEIVLGNVGAEYEEDVELEQKRVDLIHSAAVVLRQSSLIKYDEKTGRLGATELGR
IASHYYITHGSMKTSEFKYMPVRQDEKVEVGKLLTQVPIPVKESVEEAQAKINVLLQAFISRLRLSGLALMADMV
YVTQSAGRILRAMFEIALKKGWAGFPGCPSEVIRKAERISVPWSSYFDLDGPRMGELLGLPKQGGKVQPLTRFEW
DDELHGAAESFWIVVEDCDGDEIVYHDSFVLRKDYVPMPPNYFVSGLTLPGKFAAHTELLELQALPFNRVQTQVG
KTVCAEFALLRHWGRGDAGRAKRLGHLDGGRAIAKLTGDTATDLGLLERADLWRRRKKVQRVRLVVADDVHLTQQ
PLRVVALSVPVANARDLGDPLVRPVPLELHLQAFSNAHWPSLMLAMAKPAYLAIAQMSPTQPAMVFVPSRKQTRS
TARDLLAACLADDAPDRFLHADVAQMAPLLARLSEEALAEALAHGIAYYHEALTPADRRIVKHLYDLGAVQVLVA
SRDVCWELTSVAHLVIVMGTQLYDGREHRYVDYAVSDVLHMFGKSLCPGPDGRSRGLLMVPQPKRDYYRKFLHEA
LPVESHLHHYLHDVFVSEISTAMIESGDDAINWSTFTYFYRRLLANPSYYGLTTTTHDGLSNYMSNLVESTLRDL
ADSNIIDFDDNDGSVAPQNPAMIAAYYNISYITMQTFLLSLGPRTKLKGILEIVTSATEFETIHVRRHEGRLLRR
IYQRLPVSMSDPVYDSPHFKAFVLLQAHFSRMQLPIDLVKDQEVLLSRVLSLLSAMVDILSSDGRLNAINAMEMS
QMVVQAMWDRDSPLKQIPHFTPQVVQAANEFGVKDIYDFMEAMNPQENPDYPKLVERLGLSQKQLAQAADFTNNK
YPDLELQLDVLDADNIKAGEPAYLSIKITRNVQDDDDDDDDDDDDDKDKDKDKDKDKGTADYDSTVHAPFYPPKK
IENWWLVVGDDKNANLLAIKRVTIGRDLSVRLEYTVPSAGEHHVKLMLMSDSYIGVDQEREFVVRAAEGMDLDSD
QDDE*
Coding >OphauG2|4223
ATGTCAGATCCTCATCGCGATGTCTCTCAGTACAAGTACTCGGCCATGTCCAACCTGGTCCTCCAGGCGGACCGT
CGTTTTGTCACGAGACGAAATGACGAGGCCACTGGGGACCCAGAGTCGCTTGCCGGGCGACTCAGCATTAGAGAC
ATGGGCGGTCGCATTGCCAGAGACTCAGCACCCAAGCCCAAGAAACAGTCGGGCCTGGCTGGCATCGAGCGAGGG
GCCTTGGGAGAGGGCCAAGATGTGCTGTTGAGGGAGCAACGCAAGCGAAATGCAGAAGCCACCAAGAGCTCTGGA
GTCCTTGGCGCCAATGATGCCTTGATTGAGGGCATCACCTATCGCCCTCGGACAGCAGCCACAAGGGCGACGTTT
GATCTCATTCTTACCTCGATCGCAAGCTATATTGGTGACGTGCCGCACGAGGTTGTTCGCAGCGCCGCCGACGCG
GTTCTCGAGTATCTCAAGGATGATGACATGAAGGAAATCGACAAAAAGAAGGAGATTGACGACATTATAGGGTCC
ACACTGGGCCTAAAAGAATACAACGAGCTGGTCAACCTGGGCAAGAAAATTACAGATTATAATGCACAAGATGAC
GACGAAGCCGACGCAGGCGATGACAGCGGCAACGCTGAAATTGACGAACGTCAGGGCGTTGCTGTCACCTTTGAC
GATGAAGAAAACGAAGACGAAATGGTGCAAGAAGTACACGAGGCGTCATCAGAGGACGAAGTTGACGAGGATCAT
TATGAAGGGCAAGACACTGACGCGCCCGAGACTCACGAGGTGGTCAGTGATGACGAGGACATGGACCATGGACCC
AAGACTGGGCACGCCAGCAAGAGTGGCAATGCCGTGGCTGAGATAGCAGCCCGGGATATTGATGCATTCTGGCTA
CAGCGGCAAATCGGCATGCTTTACCCTGATGCGCATGAGCAGGCGGACAAAACCAAGGCTGCCCTTCACATCTTG
TCTGCAGAGCCTGACGAGGCTGGCGACGAGGAAAAGTCTCTCCGTGAGGTGGAGAATGAGCTCATGGAGCTCTTC
GACTTTGAGCACCATGAGCTCGTTCAGCGCCTTGTGGAAAACAGGGAAAGGGTGTACTGGCTGACAAAGCTGGCA
AGGGCCGAGACTGCTGAACAACGGGCTCAAGTTGAACGAGAGATTGCGTCTGAGGGCCTGCAGGGCCTACTGACG
GAGCTTAGAGGTGGCGATGCCAATGGCGACGCCGACAAGGCCAGGATGGAAATCAAGATGGACATTGACGTGCCT
GCGTCTCTTGTCGCAGAAAAGGGAGGCGATGAAAAGGCCGAGGGGTATTTGGTGGGCGGCCTGCAGCCAAAGAAG
CTCATCAACCTTGAGAACCTGGTTTTTGACCAAGGCAACCACTTGATGACGAACCAAAAGGTCAGACTGCCCGAG
GGCTCGACAAAGCGCACCTTTAAGGGCTACGAGGAGATTCACGTTCCGCCGCCAAAGAAACGCAACGATGCGGAA
GATGCTTTGATACCCATTAGCGACCTGCCAGAGTGGTGTCGAGGCCCCTTTAGCACGACGCGGTCGCTCAACAAG
ATTCAGTCCAAGTGCTATCCCTCAGCCTTTGAAGGCGACGGCAACATGCTCAACCGCGATGCAGAGACGGGCGAG
ATCGATCTCGACGCTTTCAAGATTGTGTATATTGCTCCACTCAAGGCCCTAGTACAGGAGCAGCTCACCAAGCAG
CAAATAGCCGAGACTCAAATCATTGTGACGACGCCCGAGAAGTGGGATGTGGTGACGCGAAAGGCCAACGACCTG
ACATACACCAACCTTGTGCGTCTCATCATTATTGATGAAATCCATCTGCTGCACGACGAGCGCGGCCCTGTGCTG
GAGAGCATAGTAAGCAGGACGATTCGCAAGACGGAGCAAACTGGCGAAGCGGTGCGGCTTGTGGGCTTGTCTGCG
ACGCTCCCCAACTACCGGGACGTGGCAAGCTTTTTGCGAGAGTTTATCGGGGTGACAGATCGCAAGGCTATCAAG
CAAGTCAAGACGATGAACGAGATGCTCATTTTTGTCCACTCGCGCAAGGACACGGCCAAGACGGCCAAGTACATA
CGGGACAAGGCGGTGGACATGGAAACAATCAACAAAATCTTGCGGCATGACGCTGGAAGCCGAGAAGTGCTCAAC
GAGGCAGCCAGCCAGGCTACAGATCAGGACCTCAAAGACCTGCTGCCGCATGGCTTTGGGATCCATCACGCAGGG
ATGAACCGCGTGGACAGGAGCGACGTGGAAGACTTGTTTGCCAGGGGGGCGATCCAGGTGCTAGTGTGCACGGCA
ACGCTGGCGTGGGGAGTCAACCTTCCGGCACACACAGTCATCATCAAGGGCACACAGGTCTACTCTCCGGAAAAG
GGCAGCTGGTACGACACGTACGGCGAAGGCATCATCATCACGACGCAGAGCGAGATGCAGTACTACCTGTCACTT
CTCAACCAGCAGCTCCCGATTGAGAGCCAGTTTGCTAGCAAGCTTGTGGATAATCTCAATGCGGAGATTGTGCTG
GGCAATGTTGGGGCCGAGTATGAGGAGGACGTGGAACTGGAGCAGAAACGCGTGGACCTGATACACTCGGCAGCC
GTGGTGCTCCGGCAGTCGAGCCTCATCAAGTACGATGAAAAGACGGGGCGACTTGGGGCGACGGAGCTGGGGCGG
ATTGCGTCGCACTACTACATTACGCACGGATCGATGAAGACCTCCGAGTTCAAGTACATGCCGGTGCGGCAGGAC
GAAAAGGTGGAAGTGGGCAAGCTGCTGACGCAGGTGCCGATTCCGGTCAAGGAGAGCGTGGAGGAGGCGCAGGCC
AAGATCAACGTTCTGCTGCAGGCCTTTATCTCGCGGCTGCGGCTGTCGGGGCTGGCGCTCATGGCGGACATGGTG
TATGTGACGCAGAGCGCGGGCAGGATCCTGAGGGCCATGTTTGAGATTGCGCTCAAGAAGGGGTGGGCGGGGTTT
CCGGGGTGCCCGAGCGAGGTGATTCGCAAGGCGGAGCGCATCAGCGTGCCGTGGAGCAGCTACTTTGACCTGGAT
GGGCCGCGGATGGGGGAGCTGCTGGGGCTGCCCAAGCAGGGCGGCAAGGTGCAGCCGCTGACGCGGTTTGAGTGG
GACGACGAGCTGCACGGGGCGGCGGAGAGCTTCTGGATCGTGGTGGAGGACTGCGACGGCGACGAGATTGTCTAC
CACGACAGCTTTGTGCTGCGCAAGGACTACGTGCCCATGCCGCCCAACTACTTTGTGTCGGGGCTGACGCTGCCG
GGCAAGTTTGCGGCGCACACGGAGCTGCTGGAGCTGCAGGCGCTGCCGTTCAACCGGGTGCAGACGCAGGTCGGC
AAGACGGTGTGCGCCGAGTTTGCGCTGCTGCGGCACTGGGGGCGCGGCGACGCGGGCCGGGCCAAGCGGCTGGGG
CACCTGGACGGCGGGCGGGCCATTGCCAAGCTGACGGGCGACACGGCGACGGACCTGGGGCTGCTGGAGCGCGCG
GACCTGTGGAGGCGGCGCAAGAAGGTGCAGCGCGTGCGGCTGGTGGTGGCGGACGACGTGCACCTGACGCAGCAG
CCGCTGCGCGTCGTGGCGCTGAGCGTGCCCGTGGCCAACGCGCGCGACCTGGGCGACCCGCTGGTGCGCCCCGTG
CCGCTCGAGCTGCACCTGCAGGCCTTTAGCAACGCCCACTGGCCCTCGCTGATGCTGGCCATGGCCAAGCCGGCC
TATCTGGCCATTGCGCAAATGTCGCCCACGCAGCCCGCCATGGTGTTTGTGCCCAGCCGCAAGCAGACGCGCAGC
ACCGCCCGCGACCTGCTGGCCGCCTGCCTGGCCGACGACGCCCCCGACCGCTTCCTGCACGCCGACGTGGCCCAG
ATGGCCCCGCTGCTGGCGCGCCTGTCCGAGGAGGCCCTGGCCGAGGCCCTGGCCCACGGCATCGCCTACTACCAC
GAGGCCCTGACGCCCGCCGACCGCCGCATCGTCAAGCACCTCTACGACCTGGGCGCCGTCCAGGTGCTCGTGGCG
TCGCGCGACGTGTGCTGGGAGCTGACGAGCGTCGCCCACCTCGTCATTGTCATGGGCACCCAGCTCTACGACGGC
CGCGAGCACCGCTACGTCGACTACGCCGTCAGCGACGTGCTGCACATGTTTGGCAAGTCGCTGTGCCCCGGCCCC
GATGGCCGCTCGCGCGGCCTGCTCATGGTGCCCCAGCCCAAGCGCGACTACTACCGCAAGTTCCTCCACGAGGCC
CTGCCCGTCGAGTCGCATCTGCACCACTACCTGCACGACGTCTTTGTCTCCGAAATCAGCACCGCCATGATTGAG
TCGGGCGACGACGCCATCAACTGGTCCACCTTTACCTACTTCTACCGCCGCCTGCTCGCCAACCCCAGCTACTAC
GGCCTGACCACCACCACCCACGACGGCCTCAGCAACTACATGTCCAACCTGGTCGAGTCCACCCTGCGCGACCTG
GCCGACTCCAACATCATCGACTTTGATGACAATGACGGCTCCGTCGCCCCCCAGAACCCCGCCATGATTGCCGCC
TACTACAACATCTCGTACATCACCATGCAAACCTTTCTCCTCTCTCTCGGCCCCCGCACCAAGCTCAAGGGCATC
CTGGAAATCGTCACCTCGGCCACCGAGTTCGAGACCATCCACGTCCGCCGCCACGAGGGCCGCCTGTTGCGCCGC
ATCTACCAGCGCCTGCCCGTCTCCATGTCCGACCCCGTCTACGACTCGCCTCACTTCAAGGCCTTTGTCTTGCTC
CAGGCCCACTTTTCCCGCATGCAGCTGCCCATAGACCTTGTCAAGGACCAGGAAGTCTTGCTGTCCAGGGTCCTT
AGCCTCCTGAGCGCCATGGTGGACATTCTCTCCTCTGACGGCCGCCTCAACGCAATCAACGCCATGGAGATGTCG
CAAATGGTGGTCCAGGCCATGTGGGACCGGGACAGCCCCTTGAAGCAAATCCCTCACTTTACCCCTCAGGTTGTC
CAGGCTGCCAATGAATTTGGAGTCAAGGACATTTACGACTTCATGGAGGCCATGAATCCCCAAGAAAACCCCGAC
TACCCAAAGCTGGTCGAGCGTCTAGGTCTTTCGCAGAAGCAGCTAGCTCAGGCCGCCGACTTTACCAACAACAAG
TATCCCGACCTCGAGCTCCAACTCGACGTGCTCGATGCCGACAACATCAAGGCAGGCGAGCCCGCCTACCTGAGC
ATCAAGATTACGCGCAACGTCCAAGACGACGACGACGACGACGACGACGACGACGACGACGACAAGGACAAGGAC
AAGGACAAGGACAAGGACAAGGGCACGGCCGACTATGATTCTACCGTCCACGCCCCCTTTTATCCGCCCAAAAAG
ATTGAGAATTGGTGGCTGGTGGTGGGTGACGACAAGAATGCTAACCTGCTGGCCATCAAGAGGGTGACAATTGGA
CGCGACTTGTCGGTGCGGCTCGAGTACACCGTGCCGTCAGCGGGCGAGCACCATGTCAAGTTGATGTTGATGAGC
GACAGCTACATTGGCGTGGACCAAGAACGCGAGTTTGTCGTCAGGGCGGCTGAGGGAATGGACCTTGATTCAGAC
CAAGATGACGAATAG
Transcript >OphauG2|4223
ATGTCAGATCCTCATCGCGATGTCTCTCAGTACAAGTACTCGGCCATGTCCAACCTGGTCCTCCAGGCGGACCGT
CGTTTTGTCACGAGACGAAATGACGAGGCCACTGGGGACCCAGAGTCGCTTGCCGGGCGACTCAGCATTAGAGAC
ATGGGCGGTCGCATTGCCAGAGACTCAGCACCCAAGCCCAAGAAACAGTCGGGCCTGGCTGGCATCGAGCGAGGG
GCCTTGGGAGAGGGCCAAGATGTGCTGTTGAGGGAGCAACGCAAGCGAAATGCAGAAGCCACCAAGAGCTCTGGA
GTCCTTGGCGCCAATGATGCCTTGATTGAGGGCATCACCTATCGCCCTCGGACAGCAGCCACAAGGGCGACGTTT
GATCTCATTCTTACCTCGATCGCAAGCTATATTGGTGACGTGCCGCACGAGGTTGTTCGCAGCGCCGCCGACGCG
GTTCTCGAGTATCTCAAGGATGATGACATGAAGGAAATCGACAAAAAGAAGGAGATTGACGACATTATAGGGTCC
ACACTGGGCCTAAAAGAATACAACGAGCTGGTCAACCTGGGCAAGAAAATTACAGATTATAATGCACAAGATGAC
GACGAAGCCGACGCAGGCGATGACAGCGGCAACGCTGAAATTGACGAACGTCAGGGCGTTGCTGTCACCTTTGAC
GATGAAGAAAACGAAGACGAAATGGTGCAAGAAGTACACGAGGCGTCATCAGAGGACGAAGTTGACGAGGATCAT
TATGAAGGGCAAGACACTGACGCGCCCGAGACTCACGAGGTGGTCAGTGATGACGAGGACATGGACCATGGACCC
AAGACTGGGCACGCCAGCAAGAGTGGCAATGCCGTGGCTGAGATAGCAGCCCGGGATATTGATGCATTCTGGCTA
CAGCGGCAAATCGGCATGCTTTACCCTGATGCGCATGAGCAGGCGGACAAAACCAAGGCTGCCCTTCACATCTTG
TCTGCAGAGCCTGACGAGGCTGGCGACGAGGAAAAGTCTCTCCGTGAGGTGGAGAATGAGCTCATGGAGCTCTTC
GACTTTGAGCACCATGAGCTCGTTCAGCGCCTTGTGGAAAACAGGGAAAGGGTGTACTGGCTGACAAAGCTGGCA
AGGGCCGAGACTGCTGAACAACGGGCTCAAGTTGAACGAGAGATTGCGTCTGAGGGCCTGCAGGGCCTACTGACG
GAGCTTAGAGGTGGCGATGCCAATGGCGACGCCGACAAGGCCAGGATGGAAATCAAGATGGACATTGACGTGCCT
GCGTCTCTTGTCGCAGAAAAGGGAGGCGATGAAAAGGCCGAGGGGTATTTGGTGGGCGGCCTGCAGCCAAAGAAG
CTCATCAACCTTGAGAACCTGGTTTTTGACCAAGGCAACCACTTGATGACGAACCAAAAGGTCAGACTGCCCGAG
GGCTCGACAAAGCGCACCTTTAAGGGCTACGAGGAGATTCACGTTCCGCCGCCAAAGAAACGCAACGATGCGGAA
GATGCTTTGATACCCATTAGCGACCTGCCAGAGTGGTGTCGAGGCCCCTTTAGCACGACGCGGTCGCTCAACAAG
ATTCAGTCCAAGTGCTATCCCTCAGCCTTTGAAGGCGACGGCAACATGCTCAACCGCGATGCAGAGACGGGCGAG
ATCGATCTCGACGCTTTCAAGATTGTGTATATTGCTCCACTCAAGGCCCTAGTACAGGAGCAGCTCACCAAGCAG
CAAATAGCCGAGACTCAAATCATTGTGACGACGCCCGAGAAGTGGGATGTGGTGACGCGAAAGGCCAACGACCTG
ACATACACCAACCTTGTGCGTCTCATCATTATTGATGAAATCCATCTGCTGCACGACGAGCGCGGCCCTGTGCTG
GAGAGCATAGTAAGCAGGACGATTCGCAAGACGGAGCAAACTGGCGAAGCGGTGCGGCTTGTGGGCTTGTCTGCG
ACGCTCCCCAACTACCGGGACGTGGCAAGCTTTTTGCGAGAGTTTATCGGGGTGACAGATCGCAAGGCTATCAAG
CAAGTCAAGACGATGAACGAGATGCTCATTTTTGTCCACTCGCGCAAGGACACGGCCAAGACGGCCAAGTACATA
CGGGACAAGGCGGTGGACATGGAAACAATCAACAAAATCTTGCGGCATGACGCTGGAAGCCGAGAAGTGCTCAAC
GAGGCAGCCAGCCAGGCTACAGATCAGGACCTCAAAGACCTGCTGCCGCATGGCTTTGGGATCCATCACGCAGGG
ATGAACCGCGTGGACAGGAGCGACGTGGAAGACTTGTTTGCCAGGGGGGCGATCCAGGTGCTAGTGTGCACGGCA
ACGCTGGCGTGGGGAGTCAACCTTCCGGCACACACAGTCATCATCAAGGGCACACAGGTCTACTCTCCGGAAAAG
GGCAGCTGGTACGACACGTACGGCGAAGGCATCATCATCACGACGCAGAGCGAGATGCAGTACTACCTGTCACTT
CTCAACCAGCAGCTCCCGATTGAGAGCCAGTTTGCTAGCAAGCTTGTGGATAATCTCAATGCGGAGATTGTGCTG
GGCAATGTTGGGGCCGAGTATGAGGAGGACGTGGAACTGGAGCAGAAACGCGTGGACCTGATACACTCGGCAGCC
GTGGTGCTCCGGCAGTCGAGCCTCATCAAGTACGATGAAAAGACGGGGCGACTTGGGGCGACGGAGCTGGGGCGG
ATTGCGTCGCACTACTACATTACGCACGGATCGATGAAGACCTCCGAGTTCAAGTACATGCCGGTGCGGCAGGAC
GAAAAGGTGGAAGTGGGCAAGCTGCTGACGCAGGTGCCGATTCCGGTCAAGGAGAGCGTGGAGGAGGCGCAGGCC
AAGATCAACGTTCTGCTGCAGGCCTTTATCTCGCGGCTGCGGCTGTCGGGGCTGGCGCTCATGGCGGACATGGTG
TATGTGACGCAGAGCGCGGGCAGGATCCTGAGGGCCATGTTTGAGATTGCGCTCAAGAAGGGGTGGGCGGGGTTT
CCGGGGTGCCCGAGCGAGGTGATTCGCAAGGCGGAGCGCATCAGCGTGCCGTGGAGCAGCTACTTTGACCTGGAT
GGGCCGCGGATGGGGGAGCTGCTGGGGCTGCCCAAGCAGGGCGGCAAGGTGCAGCCGCTGACGCGGTTTGAGTGG
GACGACGAGCTGCACGGGGCGGCGGAGAGCTTCTGGATCGTGGTGGAGGACTGCGACGGCGACGAGATTGTCTAC
CACGACAGCTTTGTGCTGCGCAAGGACTACGTGCCCATGCCGCCCAACTACTTTGTGTCGGGGCTGACGCTGCCG
GGCAAGTTTGCGGCGCACACGGAGCTGCTGGAGCTGCAGGCGCTGCCGTTCAACCGGGTGCAGACGCAGGTCGGC
AAGACGGTGTGCGCCGAGTTTGCGCTGCTGCGGCACTGGGGGCGCGGCGACGCGGGCCGGGCCAAGCGGCTGGGG
CACCTGGACGGCGGGCGGGCCATTGCCAAGCTGACGGGCGACACGGCGACGGACCTGGGGCTGCTGGAGCGCGCG
GACCTGTGGAGGCGGCGCAAGAAGGTGCAGCGCGTGCGGCTGGTGGTGGCGGACGACGTGCACCTGACGCAGCAG
CCGCTGCGCGTCGTGGCGCTGAGCGTGCCCGTGGCCAACGCGCGCGACCTGGGCGACCCGCTGGTGCGCCCCGTG
CCGCTCGAGCTGCACCTGCAGGCCTTTAGCAACGCCCACTGGCCCTCGCTGATGCTGGCCATGGCCAAGCCGGCC
TATCTGGCCATTGCGCAAATGTCGCCCACGCAGCCCGCCATGGTGTTTGTGCCCAGCCGCAAGCAGACGCGCAGC
ACCGCCCGCGACCTGCTGGCCGCCTGCCTGGCCGACGACGCCCCCGACCGCTTCCTGCACGCCGACGTGGCCCAG
ATGGCCCCGCTGCTGGCGCGCCTGTCCGAGGAGGCCCTGGCCGAGGCCCTGGCCCACGGCATCGCCTACTACCAC
GAGGCCCTGACGCCCGCCGACCGCCGCATCGTCAAGCACCTCTACGACCTGGGCGCCGTCCAGGTGCTCGTGGCG
TCGCGCGACGTGTGCTGGGAGCTGACGAGCGTCGCCCACCTCGTCATTGTCATGGGCACCCAGCTCTACGACGGC
CGCGAGCACCGCTACGTCGACTACGCCGTCAGCGACGTGCTGCACATGTTTGGCAAGTCGCTGTGCCCCGGCCCC
GATGGCCGCTCGCGCGGCCTGCTCATGGTGCCCCAGCCCAAGCGCGACTACTACCGCAAGTTCCTCCACGAGGCC
CTGCCCGTCGAGTCGCATCTGCACCACTACCTGCACGACGTCTTTGTCTCCGAAATCAGCACCGCCATGATTGAG
TCGGGCGACGACGCCATCAACTGGTCCACCTTTACCTACTTCTACCGCCGCCTGCTCGCCAACCCCAGCTACTAC
GGCCTGACCACCACCACCCACGACGGCCTCAGCAACTACATGTCCAACCTGGTCGAGTCCACCCTGCGCGACCTG
GCCGACTCCAACATCATCGACTTTGATGACAATGACGGCTCCGTCGCCCCCCAGAACCCCGCCATGATTGCCGCC
TACTACAACATCTCGTACATCACCATGCAAACCTTTCTCCTCTCTCTCGGCCCCCGCACCAAGCTCAAGGGCATC
CTGGAAATCGTCACCTCGGCCACCGAGTTCGAGACCATCCACGTCCGCCGCCACGAGGGCCGCCTGTTGCGCCGC
ATCTACCAGCGCCTGCCCGTCTCCATGTCCGACCCCGTCTACGACTCGCCTCACTTCAAGGCCTTTGTCTTGCTC
CAGGCCCACTTTTCCCGCATGCAGCTGCCCATAGACCTTGTCAAGGACCAGGAAGTCTTGCTGTCCAGGGTCCTT
AGCCTCCTGAGCGCCATGGTGGACATTCTCTCCTCTGACGGCCGCCTCAACGCAATCAACGCCATGGAGATGTCG
CAAATGGTGGTCCAGGCCATGTGGGACCGGGACAGCCCCTTGAAGCAAATCCCTCACTTTACCCCTCAGGTTGTC
CAGGCTGCCAATGAATTTGGAGTCAAGGACATTTACGACTTCATGGAGGCCATGAATCCCCAAGAAAACCCCGAC
TACCCAAAGCTGGTCGAGCGTCTAGGTCTTTCGCAGAAGCAGCTAGCTCAGGCCGCCGACTTTACCAACAACAAG
TATCCCGACCTCGAGCTCCAACTCGACGTGCTCGATGCCGACAACATCAAGGCAGGCGAGCCCGCCTACCTGAGC
ATCAAGATTACGCGCAACGTCCAAGACGACGACGACGACGACGACGACGACGACGACGACGACAAGGACAAGGAC
AAGGACAAGGACAAGGACAAGGGCACGGCCGACTATGATTCTACCGTCCACGCCCCCTTTTATCCGCCCAAAAAG
ATTGAGAATTGGTGGCTGGTGGTGGGTGACGACAAGAATGCTAACCTGCTGGCCATCAAGAGGGTGACAATTGGA
CGCGACTTGTCGGTGCGGCTCGAGTACACCGTGCCGTCAGCGGGCGAGCACCATGTCAAGTTGATGTTGATGAGC
GACAGCTACATTGGCGTGGACCAAGAACGCGAGTTTGTCGTCAGGGCGGCTGAGGGAATGGACCTTGATTCAGAC
CAAGATGACGAATAG
Gene >OphauG2|4223
ATGTCAGATCCTCATCGCGATGTCTCTCAGTACAAGTACTCGGCCATGTCCAACCTGGTCCTCCAGGCGGACCGT
CGTTTTGTCACGAGACGAAATGACGAGGCCACTGGGGACCCAGAGTCGCTTGCCGGGCGACTCAGCATTAGAGAC
ATGGGCGGTCGCATTGCCAGAGACTCAGCACCCAAGCCCAAGAAACAGTCGGGCCTGGCTGGCATCGAGCGAGGG
GCCTTGGGAGAGGGCCAAGATGTGCTGTTGAGGGAGCAACGCAAGCGAAATGCAGAAGCCACCAAGAGCTCTGGA
GTCCTTGGCGCCAATGATGCCTTGATTGAGGGCATCACCTATCGCCCTCGGACAGCAGCCACAAGGGCGACGTTT
GATCTCATTCTTACCTCGATCGCAAGCTATATTGGTGACGTGCCGCACGAGGTTGTTCGCAGCGCCGCCGACGCG
GTTCTCGAGTATCTCAAGGATGATGACATGAAGGAAATCGACAAAAAGAAGGAGATTGACGACATTATAGGGTCC
ACACTGGGCCTAAAAGAATACAACGAGCTGGTCAACCTGGGCAAGAAAATTACAGATTATAATGCACAAGATGAC
GACGAAGCCGACGCAGGCGATGACAGCGGCAACGCTGAAATTGACGAACGTCAGGGCGTTGCTGTCACCTTTGAC
GATGAAGAAAACGAAGACGAAATGGTGCAAGAAGTACACGAGGCGTCATCAGAGGACGAAGTTGACGAGGATCAT
TATGAAGGGCAAGACACTGACGCGCCCGAGACTCACGAGGTGGTCAGTGATGACGAGGACATGGACCATGGACCC
AAGACTGGGCACGCCAGCAAGAGTGGCAATGCCGTGGCTGAGATAGCAGCCCGGGATATTGATGCATTCTGGCTA
CAGCGGCAAATCGGCATGCTTTACCCTGATGCGCATGAGCAGGCGGACAAAACCAAGGCTGCCCTTCACATCTTG
TCTGCAGAGCCTGACGAGGCTGGCGACGAGGAAAAGTCTCTCCGTGAGGTGGAGAATGAGCTCATGGAGCTCTTC
GACTTTGAGCACCATGAGCTCGTTCAGCGCCTTGTGGAAAACAGGGAAAGGGTGTACTGGCTGACAAAGCTGGCA
AGGGCCGAGACTGCTGAACAACGGGCTCAAGTTGAACGAGAGATTGCGTCTGAGGGCCTGCAGGGCCTACTGACG
GAGCTTAGAGGTGGCGATGCCAATGGCGACGCCGACAAGGCCAGGATGGAAATCAAGATGGACATTGACGTGCCT
GCGTCTCTTGTCGCAGAAAAGGGAGGCGATGAAAAGGCCGAGGGGTATTTGGTGGGCGGCCTGCAGCCAAAGAAG
CTCATCAACCTTGAGAACCTGGTTTTTGACCAAGGCAACCACTTGATGACGAACCAAAAGGTCAGACTGCCCGAG
GGCTCGACAAAGCGCACCTTTAAGGGCTACGAGGAGATTCACGTTCCGCCGCCAAAGAAACGCAACGATGCGGAA
GATGCTTTGATACCCATTAGCGACCTGCCAGAGTGGTGTCGAGGCCCCTTTAGCACGACGCGGTCGCTCAACAAG
ATTCAGTCCAAGTGCTATCCCTCAGCCTTTGAAGGCGACGGCAACATGCTCGTTTGTGCGCCGACGGGCAGTGGA
AAGACCAATGTTTCCATGTTGGCCATTCTGAGAGAGATTGGCAAGAACCGCGATGCAGAGACGGGCGAGATCGAT
CTCGACGCTTTCAAGATTGTGTATATTGCTCCACTCAAGGCCCTAGTACAGGAGCAGGTGGGCAATTTCGGCAAA
CGACTGGAGCCGTACGGGATTCGCGTGTCCGAATTGACGGGCGACCGGCAGCTCACCAAGCAGCAAATAGCCGAG
ACTCAAATCATTGTGACGACGCCCGAGAAGTGGGATGTGGTGACGCGAAAGGCCAACGACCTGACATACACCAAC
CTTGTGCGTCTCATCATTATTGATGAAATCCATCTGCTGCACGACGAGCGCGGCCCTGTGCTGGAGAGCATAGTA
AGCAGGACGATTCGCAAGACGGAGCAAACTGGCGAAGCGGTGCGGCTTGTGGGCTTGTCTGCGACGCTCCCCAAC
TACCGGGACGTGGCAAGCTTTTTGCGAGTGGACATGGAAAAGGACCTCTTTCACTTTGACGGGTCGTACAGGCCA
TGCCCCCTAAAACAGGAGTTTATCGGGGTGACAGATCGCAAGGCTATCAAGCAAGTCAAGACGATGAACGAGGTG
ACGTACCAAAAGGTGCTGGAGCACGTTGGGACGCATAGGAACCAGATGCTCATTTTTGTCCACTCGCGCAAGGAC
ACGGCCAAGACGGCCAAGTACATACGGGACAAGGCGGTGGACATGGAAACAATCAACAAAATCTTGCGGCATGAC
GCTGGAAGCCGAGAAGTGCTCAACGAGGCAGCCAGCCAGGCTACAGATCAGGACCTCAAAGACCTGCTGCCGCAT
GGCTTTGGGATCCATCACGCAGGGATGAACCGCGTGGACAGGAGCGACGTGGAAGACTTGTTTGCCAGGGGGGCG
ATCCAGGTGCTAGTGTGCACGGCAACGCTGGCGTGGGGAGTCAACCTTCCGGCACACACAGTCATCATCAAGGGC
ACACAGGTCTACTCTCCGGAAAAGGGCAGCTGGGTGGAGCTTAGTCCGCAAGATGTGCTCCAGATGCTCGGGCGA
GCAGGGCGGCCGCAGTACGACACGTACGGCGAAGGCATCATCATCACGACGCAGAGCGAGATGCAGTACTACCTG
TCACTTCTCAACCAGCAGCTCCCGATTGAGAGCCAGTTTGCTAGCAAGCTTGTGGATAATCTCAATGCGGAGATT
GTGCTGGGCAATGTGAGGACGCGGGACGAGGGGGTGGAGTGGCTGGGCTACACATATCTGTTTGTGCGGATGCTC
CGGTCTCCCGGGCTGTACCAGGTTGGGGCCGAGTATGAGGAGGACGTGGAACTGGAGCAGAAACGCGTGGACCTG
ATACACTCGGCAGCCGTGGTGCTCCGGCAGTCGAGCCTCATCAAGTACGATGAAAAGACGGGGCGACTTGGGGCG
ACGGAGCTGGGGCGGATTGCGTCGCACTACTACATTACGCACGGATCGATGAAGACGTACAATATGCACATGCAG
GGGTCGACGAATGCAATCGATCTGTTCCGGGTGTTTGCTCTCAGCTCCGAGTTCAAGTACATGCCGGTGCGGCAG
GACGAAAAGGTGGAAGTGGGCAAGCTGCTGACGCAGGTGCCGATTCCGGTCAAGGAGAGCGTGGAGGAGGCGCAG
GCCAAGATCAACGTTCTGCTGCAGGCCTTTATCTCGCGGCTGCGGCTGTCGGGGCTGGCGCTCATGGCGGACATG
GTGTATGTGACGCAGAGCGCGGGCAGGATCCTGAGGGCCATGTTTGAGATTGCGCTCAAGAAGGGGTGGGCGGGG
GTGGCCAAGACGGCGCTGGAGCTGTGCAAGATGGCAGAGAAGCGCATGTGGCCGACCATGTCGCCGCTGCGGCAG
TTTCCGGGGTGCCCGAGCGAGGTGATTCGCAAGGCGGAGCGCATCAGCGTGCCGTGGAGCAGCTACTTTGACCTG
GATGGGCCGCGGATGGGGGAGCTGCTGGGGCTGCCCAAGCAGGGCGGCAAGGTGTGCGGCATGGTGGGCAAGTTC
CCGCGGGTGCAGGTGCAGGCGCAGGTGCAGCCGCTGACGCGGTCGATGCTGCGGGTGGAGCTGAGCATTACGGGC
AGGTTTGAGTGGGACGACGAGCTGCACGGGGCGGCGGAGAGCTTCTGGATCGTGGTGGAGGACTGCGACGGCGAC
GAGATTGTCTACCACGACAGCTTTGTGCTGCGCAAGGACTACGTGGTGGGCGAGGCCAAGGAGCACGTGGTGGAG
TTTTGCGTGGAGATTGGCGAGCCCATGCCGCCCAACTACTTTGTGTCGGTGATTTCGGACCGGTGGATGCTGGCG
CAGACCAAGCTGGCGCTGCCGTTTGAGGGGCTGACGCTGCCGGGCAAGTTTGCGGCGCACACGGAGCTGCTGGAG
CTGCAGGCGCTGCCGGTGGCGGCGCTCAAGGAGGCGAGCCACGCGGCGCTGTACGCGGGGTGGACGCAGTTCAAC
CGGGTGCAGACGCAGGTGTTCAACTCGCTGTACAAGGGCGACGACAATGTGTTTATCGGGGCGCCGACGGGCAGC
GGCAAGACGGTGTGCGCCGAGTTTGCGCTGCTGCGGCACTGGGGGCGCGGCGACGCGGGCCGGGCCGTGTACCTG
GCGCCCTTGCAGGAGGCGGTGGACGTGCGGCTGGCCGACTGGCAGAAGCGGCTGGGGCACCTGGACGGCGGGCGG
GCCATTGCCAAGCTGACGGGCGACACGGCGACGGACCTGGGGCTGCTGGAGCGCGCGGACCTGGTGCTGGCGACG
CCGGGGCAGTGGGAGACGCTGTCGCGGCAGTGGAGGCGGCGCAAGAAGGTGCAGCGCGTGCGGCTGGTGGTGGCG
GACGACGTGCACCTGGTGGACGGGCCGCAGGGCCATGTGTACGAGGTGGTGCTGTCGCGCATGCACTACATGGGC
ACGCAGACGCAGCAGCCGCTGCGCGTCGTGGCGCTGAGCGTGCCCGTGGCCAACGCGCGCGACCTGGGCGAGTGG
GTGGACGCGCGCGGCCACTGCATCTACAACTTCAGCCCGCTGGTGCGCCCCGTGCCGCTCGAGCTGCACCTGCAG
GCCTTTAGCAACGCCCACTGGCCCTCGCTGATGCTGGCCATGGCCAAGCCGGCCTATCTGGCCATTGCGCAAATG
TCGCCCACGCAGCCCGCCATGGTGTTTGTGCCCAGCCGCAAGCAGACGCGCAGCACCGCCCGCGACCTGCTGGCC
GCCTGCCTGGCCGACGACGCCCCCGACCGCTTCCTGCACGCCGACGTGGCCCAGATGGCCCCGCTGCTGGCGCGC
CTGTCCGAGGAGGCCCTGGCCGAGGCCCTGGCCCACGGCATCGCCTACTACCACGAGGCCCTGACGCCCGCCGAC
CGCCGCATCGTCAAGCACCTCTACGACCTGGGCGCCGTCCAGGTGCTCGTGGCGTCGCGCGACGTGTGCTGGGAG
CTGACGAGCGTCGCCCACCTCGTCATTGTCATGGGCACCCAGCTCTACGACGGCCGCGAGCACCGCTACGTCGAC
TACGCCGTCAGCGACGTGCTGCACATGTTTGGCAAGTCGCTGTGCCCCGGCCCCGATGGCCGCTCGCGCGGCCTG
CTCATGGTGCCCCAGCCCAAGCGCGACTACTACCGCAAGTTCCTCCACGAGGCCCTGCCCGTCGAGTCGCATCTG
CACCACTACCTGCACGACGTCTTTGTCTCCGAAATCAGCACCGCCATGATTGAGTCGGGCGACGACGCCATCAAC
TGGTCCACCTTTACCTACTTCTACCGCCGCCTGCTCGCCAACCCCAGCTACTACGGCCTGACCACCACCACCCAC
GACGGCCTCAGCAACTACATGTCCAACCTGGTCGAGTCCACCCTGCGCGACCTGGCCGACTCCAACATCATCGAC
TTTGATGACAATGACGGCTCCGTCGCCCCCCAGAACCCCGCCATGATTGCCGCCTACTACAACATCTCGTACATC
ACCATGCAAACCTTTCTCCTCTCTCTCGGCCCCCGCACCAAGCTCAAGGGCATCCTGGAAATCGTCACCTCGGCC
ACCGAGTTCGAGACCATCCACGTCCGCCGCCACGAGGGCCGCCTGTTGCGCCGCATCTACCAGCGCCTGCCCGTC
TCCATGTCCGACCCCGTCTACGACTCGCCTCACTTCAAGGCCTTTGTCTTGCTCCAGGCCCACTTTTCCCGCATG
CAGCTGCCCATAGACCTTGTCAAGGACCAGGAAGTCTTGCTGTCCAGGGTCCTTAGCCTCCTGAGCGCCATGGTG
GACATTCTCTCCTCTGACGGCCGCCTCAACGCAATCAACGCCATGGAGATGTCGCAAATGGTGGTCCAGGCCATG
TGGGACCGGGACAGCCCCTTGAAGCAAATCCCTCACTTTACCCCTCAGGTTGTCCAGGCTGCCAATGAATTTGGG
TATTTTTCATCTCCTTTCCCCCTTTTCAAGTCTGCCTCACCCATCTAAAATCTGCCACTCTACTAACCCGTGTGC
ATCTCGCAACAGAGTCAAGGACATTTACGACTTCATGGAGGCCATGAATCCCCAAGAAAACCCCGACTACCCAAA
GCTGGTCGAGCGTCTAGGTCTTTCGCAGAAGCAGCTAGCTCAGGCCGCCGACTTTACCAACAACAAGTATCCCGA
CCTCGAGCTCCAACTCGACGTGCTCGATGCCGACAACATCAAGGCAGGCGAGCCCGCCTACCTGAGCATCAAGAT
TACGCGCAACGTCCAAGACGACGACGACGACGACGACGACGACGACGACGACGACAAGGACAAGGACAAGGACAA
GGACAAGGACAAGGGCACGGCCGACTATGATTCTACCGTCCACGCCCCCTTTTATCCGCCCAAAAAGATTGAGAA
TTGGTGGCTGGTGGTGGGTGACGACAAGAATGCTAACCTGCTGGCCATCAAGAGGGTGACAATTGGACGCGACTT
GTCGGTGCGGCTCGAGTACACCGTGCCGTCAGCGGGCGAGCACCATGTCAAGTTGATGTTGATGAGCGACAGCTA
CATTGGCGTGGACCAAGAACGCGAGTTTGTCGTCAGGGCGGCTGAGGGAATGGACCTTGATTCAGACCAAGATGA
CGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail