Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4222
Gene name
LocationContig_345:120..2394
Strand-
Gene length (bp)2274
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00855 PWWP PWWP domain 6.8E-15 168 274

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09842|PDP3_SCHPO PWWP domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp3 PE=1 SV=1 414 506 4.0E-08
sp|O59676|PDP1_SCHPO PWWP domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdp1 PE=1 SV=1 419 512 9.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3521
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4222 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1853
Ophiocordyceps camponoti-floridani Ophcf2|04555
Ophiocordyceps camponoti-rufipedis Ophun1|4479
Ophiocordyceps kimflemingae Ophio5|859
Ophiocordyceps subramaniannii Hirsu2|6748

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4222
MAEKQSDKPEAAAPVASPQPAPVLEAKSTEPKLDAKDEPNPRAEKGAKEKVKAEPDTPNKAPEAPDEPQEQTDAG
KTAQDKTDKPAEQTQPAANNDTEMKDGPAGAAAQDEAPSKAEPQDAAPAAAEAPTAGKGKNARRKSVASESKAKG
LTKKASKTRLTHLDAKPGDHFLVKLKGFPAWPAIVCDESMLPAALINTRPVSAARPDGSYAEAYAQGGKRTHDRT
FPVMYLYTNEFGWVQNTMLSELTAEKAKDSITDKMRKDLRAAFELAAEHHAVEHYKQILENFEQEQIAQEEAKKQ
AAAMPKKSKKAKAKTTEEDDDVEMEDADGPPKSAKSKKRKADETNTPQRSDSVKKPKIKLNTSSTLKAANGAATP
KSGGGAASKTKSKPKKSKDGADKKADTAKEPSLDPEVRHARKEKEVLYLRHKLQRGLLTREQQPREEEMKTMSDF
ISMLENFKDLEVSIIRATKINKVLKAILKLESIPRESEFEFKKRSQKLLDKWNKLLAGEPSAPPSASTNGINGSA
GDDNKSDKNGVKSESDEQEKGQAETDKSQEGQKLHETTTRDEPTNKAKESNKADEEEKTADKADAATEPSKSEV*
Coding >OphauG2|4222
ATGGCAGAAAAGCAATCTGACAAGCCCGAGGCGGCCGCCCCCGTCGCGAGCCCTCAACCTGCTCCCGTTCTCGAG
GCCAAATCGACGGAGCCAAAACTCGACGCCAAGGACGAGCCCAACCCTCGAGCTGAGAAGGGGGCCAAGGAAAAG
GTCAAGGCCGAGCCTGACACGCCCAACAAAGCCCCCGAGGCTCCCGATGAACCCCAAGAACAAACAGATGCCGGC
AAGACTGCCCAGGATAAAACCGATAAGCCCGCCGAGCAAACCCAGCCCGCTGCAAATAACGACACCGAGATGAAG
GATGGGCCCGCCGGCGCAGCAGCCCAAGATGAAGCACCATCCAAGGCCGAGCCCCAAGATGCTGCCCCTGCTGCT
GCTGAGGCTCCCACTGCCGGCAAAGGCAAAAACGCCCGCCGCAAATCTGTTGCCAGCGAATCCAAGGCCAAGGGC
TTGACCAAGAAGGCGAGCAAGACGCGTCTTACTCATCTCGACGCGAAGCCCGGTGACCACTTTCTCGTCAAGCTC
AAGGGCTTTCCGGCATGGCCGGCCATTGTATGCGACGAGAGCATGCTCCCGGCGGCTCTCATCAACACGCGTCCC
GTCTCTGCTGCCCGGCCAGATGGAAGCTACGCTGAAGCCTATGCCCAAGGTGGCAAGCGGACACATGACAGAACG
TTTCCTGTCATGTACCTCTACACAAACGAATTTGGATGGGTTCAAAACACGATGCTCTCGGAGCTTACGGCGGAA
AAGGCAAAGGACAGCATCACTGACAAGATGCGAAAAGACCTCAGGGCGGCCTTTGAGCTTGCTGCCGAGCATCAC
GCCGTAGAACATTACAAGCAGATTCTCGAAAACTTTGAGCAAGAGCAGATTGCGCAGGAAGAGGCCAAGAAGCAG
GCCGCCGCAATGCCCAAAAAGTCCAAAAAGGCCAAGGCCAAGACGACAGAGGAAGACGACGACGTGGAAATGGAG
GATGCTGACGGACCCCCTAAATCGGCCAAGTCTAAAAAGCGCAAAGCCGACGAAACAAATACGCCGCAACGCTCC
GACTCTGTCAAGAAGCCCAAGATCAAGCTCAACACGTCATCGACTCTCAAGGCAGCTAACGGCGCCGCAACACCC
AAGTCTGGGGGTGGCGCTGCGTCCAAGACTAAATCCAAGCCCAAAAAATCCAAGGATGGTGCGGACAAGAAGGCT
GACACGGCCAAAGAGCCCAGCTTGGATCCAGAAGTTCGGCATGCTCGCAAAGAGAAAGAAGTACTCTACCTACGA
CACAAGCTTCAACGTGGACTCCTTACTCGGGAGCAGCAGCCTCGAGAGGAAGAGATGAAGACCATGTCGGATTTT
ATCAGCATGCTCGAAAACTTTAAAGATCTCGAGGTGTCGATAATTCGAGCCACCAAGATCAACAAGGTGCTAAAG
GCCATTCTCAAGCTTGAGTCGATTCCGCGCGAGTCGGAATTCGAGTTCAAGAAGCGGTCACAGAAGTTACTTGAC
AAGTGGAACAAGCTGCTTGCTGGCGAGCCGTCGGCACCCCCGTCCGCCTCTACGAATGGCATCAATGGTTCAGCT
GGCGATGACAACAAGTCGGACAAGAATGGCGTCAAGAGCGAGAGTGACGAGCAGGAAAAGGGCCAGGCTGAGACG
GACAAATCTCAGGAGGGCCAGAAACTGCACGAGACAACGACGCGGGATGAGCCGACCAACAAGGCGAAGGAATCC
AACAAAGCAGATGAGGAGGAAAAGACAGCTGACAAGGCGGACGCTGCAACGGAGCCCTCCAAAAGCGAAGTCTGA
Transcript >OphauG2|4222
ATGGCAGAAAAGCAATCTGACAAGCCCGAGGCGGCCGCCCCCGTCGCGAGCCCTCAACCTGCTCCCGTTCTCGAG
GCCAAATCGACGGAGCCAAAACTCGACGCCAAGGACGAGCCCAACCCTCGAGCTGAGAAGGGGGCCAAGGAAAAG
GTCAAGGCCGAGCCTGACACGCCCAACAAAGCCCCCGAGGCTCCCGATGAACCCCAAGAACAAACAGATGCCGGC
AAGACTGCCCAGGATAAAACCGATAAGCCCGCCGAGCAAACCCAGCCCGCTGCAAATAACGACACCGAGATGAAG
GATGGGCCCGCCGGCGCAGCAGCCCAAGATGAAGCACCATCCAAGGCCGAGCCCCAAGATGCTGCCCCTGCTGCT
GCTGAGGCTCCCACTGCCGGCAAAGGCAAAAACGCCCGCCGCAAATCTGTTGCCAGCGAATCCAAGGCCAAGGGC
TTGACCAAGAAGGCGAGCAAGACGCGTCTTACTCATCTCGACGCGAAGCCCGGTGACCACTTTCTCGTCAAGCTC
AAGGGCTTTCCGGCATGGCCGGCCATTGTATGCGACGAGAGCATGCTCCCGGCGGCTCTCATCAACACGCGTCCC
GTCTCTGCTGCCCGGCCAGATGGAAGCTACGCTGAAGCCTATGCCCAAGGTGGCAAGCGGACACATGACAGAACG
TTTCCTGTCATGTACCTCTACACAAACGAATTTGGATGGGTTCAAAACACGATGCTCTCGGAGCTTACGGCGGAA
AAGGCAAAGGACAGCATCACTGACAAGATGCGAAAAGACCTCAGGGCGGCCTTTGAGCTTGCTGCCGAGCATCAC
GCCGTAGAACATTACAAGCAGATTCTCGAAAACTTTGAGCAAGAGCAGATTGCGCAGGAAGAGGCCAAGAAGCAG
GCCGCCGCAATGCCCAAAAAGTCCAAAAAGGCCAAGGCCAAGACGACAGAGGAAGACGACGACGTGGAAATGGAG
GATGCTGACGGACCCCCTAAATCGGCCAAGTCTAAAAAGCGCAAAGCCGACGAAACAAATACGCCGCAACGCTCC
GACTCTGTCAAGAAGCCCAAGATCAAGCTCAACACGTCATCGACTCTCAAGGCAGCTAACGGCGCCGCAACACCC
AAGTCTGGGGGTGGCGCTGCGTCCAAGACTAAATCCAAGCCCAAAAAATCCAAGGATGGTGCGGACAAGAAGGCT
GACACGGCCAAAGAGCCCAGCTTGGATCCAGAAGTTCGGCATGCTCGCAAAGAGAAAGAAGTACTCTACCTACGA
CACAAGCTTCAACGTGGACTCCTTACTCGGGAGCAGCAGCCTCGAGAGGAAGAGATGAAGACCATGTCGGATTTT
ATCAGCATGCTCGAAAACTTTAAAGATCTCGAGGTGTCGATAATTCGAGCCACCAAGATCAACAAGGTGCTAAAG
GCCATTCTCAAGCTTGAGTCGATTCCGCGCGAGTCGGAATTCGAGTTCAAGAAGCGGTCACAGAAGTTACTTGAC
AAGTGGAACAAGCTGCTTGCTGGCGAGCCGTCGGCACCCCCGTCCGCCTCTACGAATGGCATCAATGGTTCAGCT
GGCGATGACAACAAGTCGGACAAGAATGGCGTCAAGAGCGAGAGTGACGAGCAGGAAAAGGGCCAGGCTGAGACG
GACAAATCTCAGGAGGGCCAGAAACTGCACGAGACAACGACGCGGGATGAGCCGACCAACAAGGCGAAGGAATCC
AACAAAGCAGATGAGGAGGAAAAGACAGCTGACAAGGCGGACGCTGCAACGGAGCCCTCCAAAAGCGAAGTCTGA
Gene >OphauG2|4222
ATGGCAGAAAAGCAATCTGACAAGCCCGAGGCGGCCGCCCCCGTCGCGAGCCCTCAACCTGCTCCCGTTCTCGAG
GCCAAATCGACGGAGCCAAAACTCGACGCCAAGGACGAGCCCAACCCTCGAGCTGAGAAGGGGGCCAAGGAAAAG
GTCAAGGCCGAGCCTGACACGCCCAACAAAGCCCCCGAGGCTCCCGATGGTGAGGTTTCGCGCCACGTGCTATTT
TGACAGCTGCCAATGCGCCTTTTCGTTTCTTGCCTCTTTTTTTTTCCCTTCTTTCTCTCTCCTTCTCTCTCTCCT
TCCCCTCCCTTCTCATTTGTTTTCTGCCTTCAGTCAGGTGTCTCAGACTCGGACGCATGCTTGTGGGGGAAAAAA
GGTCATTGACTAATGGCAACATGCAGAACCCCAAGAACAAACAGATGCCGGCAAGACTGCCCAGGATAAAACCGA
TAAGCCCGCCGAGCAAACCCAGCCCGCTGCAAATAACGACACCGAGATGAAGGATGGGCCCGCCGGCGCAGCAGC
CCAAGATGAAGCACCATCCAAGGCCGAGCCCCAAGATGCTGCCCCTGCTGCTGCTGAGGCTCCCACTGCCGGCAA
AGGCAAAAACGCCCGCCGCAAATCTGTTGCCAGCGAATCCAAGGCCAAGGGCTTGACCAAGAAGGCGAGCAAGAC
GCGTCTTACTCATCTCGACGCGAAGCCCGGTGACCACTTTCTCGTCAAGCTCAAGGGCTTTCCGGCATGGCCGGC
CATTGTATGCGACGAGAGCATGCTCCCGGCGGCTCTCATCAACACGCGTCCCGTCTCTGCTGCCCGGCCAGATGG
AAGCTACGCTGAAGCCTATGCCCAAGGTGGCAAGCGGACACATGACAGAACGTTTCCTGTCATGTACCTCTACAC
AAACGAATTGTAAGCCCCCGACGGATCCCACCATGCTTGTGGCTCAAGCTACACGTTTCTAAGACGCTTTTGTAG
TGGATGGGTTCAAAACACGATGCTCTCGGAGCTTACGGCGGAAAAGGCAAAGGACAGCATCACTGACAAGATGCG
AAAAGACCTCAGGGCGGCCTTTGAGCTTGCTGCCGAGCATCACGCCGTAGAACATTACAAGCAGATTCTCGAAAA
CTTTGAGCAAGAGCAGATTGCGCAGGAAGAGGCCAAGAAGCAGGCCGCCGCAATGCCCAAAAAGTCCAAAAAGGC
CAAGGCCAAGACGACAGAGGAAGACGACGACGTGGAAATGGAGGATGCTGACGGACCCCCTAAATCGGCCAAGTC
TAAAAAGCGCAAAGCCGACGAAACAAATGTAAGAAGCATGCACACTTGTTATGCGCCACATCTAAGCAAGAAAGA
CATGCTGACTCTTCTTTTTTTTTTCCTTCTTCGCACCGTGCCAGACGCCGCAACGCTCCGACTCTGTCAAGAAGC
CCAAGATCAAGCTCAACACGTCATCGACTCTCAAGGCAGCTAACGGCGCCGCAACACCCAAGTCTGGGGGTGGCG
CTGCGTCCAAGACTAAATCCAAGCCCAAAAAATCCAAGGATGGTGCGGACAAGAAGGCTGACACGGCCAAAGAGC
CCAGCTTGGATCCAGAAGTTCGGCATGCTCGCAAAGAGGTGAGTAGGAGGAGGTGAAGCATCATGACTTGCTGAC
GGGCGGCGCTGACATTGGAAGCAGAAAGAAGTACTCTACCTACGACACAAGCTTCAACGTGGACTCCTTACTCGG
GAGCAGCAGCCTCGAGAGGAAGAGATGAAGACCATGTCGGATTTTATCAGCATGCTCGAAAACTTTAAAGATCTC
GAGGTGTCGATAATTCGAGCCACCAAGATCAACAAGGTGCTAAAGGCCATTCTCAAGCTTGAGTCGATTCCGCGC
GAGTCGGAATTCGAGTTCAAGAAGCGGTCACAGAAGTTACTTGACAAGTGGAACAAGCTGCTTGCTGGCGAGCCG
TCGGCACCCCCGTCCGCCTCTACGAATGGCATCAATGGTTCAGCTGGCGATGACAACAAGTCGGACAAGAATGGC
GTCAAGAGCGAGAGTGACGAGCAGGAAAAGGGCCAGGCTGAGACGGACAAATCTCAGGAGGGCCAGAAACTGCAC
GAGACAACGACGCGGGATGAGCCGACCAACAAGGCGAAGGAATCCAACAAAGCAGATGAGGAGGAAAAGACAGCT
GACAAGGCGGTGGGTGCAGCACAAATCTGAAGGGTGAGTATTTGTAGCTGATGAGACGCCTAGGACGCTGCAACG
GAGCCCTCCAAAAGCGAAGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail