Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4217
Gene name
LocationContig_344:4384..6426
Strand-
Gene length (bp)2042
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18044 zf-CCCH_4 CCCH-type zinc finger 2.8E-07 3 23

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S381|AMO1_CHATD Nucleoporin AMO1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=AMO1 PE=3 SV=1 1 606 4.0E-99

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3543
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4217 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6606
Ophiocordyceps camponoti-floridani Ophcf2|05214
Ophiocordyceps camponoti-rufipedis Ophun1|4028
Ophiocordyceps kimflemingae Ophio5|5447
Ophiocordyceps subramaniannii Hirsu2|6795

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4217
MTICKFWGAGNCRYGNNCRFEHPTRTQPQNRFGTDAVSKFNKYNISVELLENDLTADLPEWILSSYAPGKNAPEQ
LFGGIQCEQSFEELRFMHMQAQAAGHEGQAIAAAQELYHGARGRIDHALRNSQDAVQFVIDGENRHPNRNDVCRQ
SSHGAPFGVFAVGVQRGPMAPKNSSFGLGIAAQQGSTFGQPSLLGQRPNAFAAPAFGQTSQPASAFGQPQQSQML
FGQAAQASNSPFGQGPSPVSTFGQPSTLGAKPNPFGAPRFGQPASPSTPGNAFGQPGQQHTQGSPFGQGAQQNTQ
GSPFGQGAQQNTQASPFGQIAQQNTQGSLFGQPSQLGQRPSMFAGASNTNAFSSLGSQNSNTNNNAPAANPFGNA
NAIQQNPFATNTLTPTTMAPSPFGQAVQQSSNPFGQQQQSSAPNPFGQATPQASSAFGQIQPPPQTNGFGQAANN
SLQNTNQPFGQPGLPRANPFGAPQTQQAQQLQQAQQTQHEAQNASESSPYPPGSSKQHPLIATFSSKGMDGRLAL
YKGKPVTYVDDKPVVRNLNGTLSRIWFPDGAPAYTSDTELPPEMYDEKTRTQWEEFASSGIFTDGTMPELPPPRE
CTRWDF*
Coding >OphauG2|4217
ATGACTATTTGCAAGTTTTGGGGGGCCGGCAACTGTCGCTATGGAAACAATTGCCGATTCGAGCACCCGACTCGA
ACCCAGCCTCAAAATCGATTTGGCACTGATGCCGTGTCGAAATTCAACAAGTACAACATAAGCGTCGAGCTTTTG
GAAAACGACTTGACGGCCGATTTGCCTGAATGGATTCTGTCGAGCTATGCTCCTGGCAAAAACGCACCCGAACAA
CTTTTTGGTGGCATCCAATGCGAGCAGAGCTTCGAAGAGCTTCGATTCATGCATATGCAGGCCCAGGCGGCGGGT
CATGAAGGGCAAGCCATTGCTGCCGCGCAAGAACTCTACCACGGCGCCAGAGGCCGAATAGACCATGCCTTGCGT
AATTCTCAAGACGCCGTGCAATTTGTCATTGATGGCGAAAACCGTCATCCCAATAGAAACGACGTTTGTCGCCAA
AGTTCTCATGGAGCGCCCTTTGGTGTTTTTGCTGTTGGCGTGCAACGTGGGCCCATGGCTCCAAAAAATTCTTCA
TTCGGCTTGGGAATCGCAGCTCAGCAAGGCAGCACTTTTGGCCAGCCCTCACTATTAGGCCAACGGCCCAATGCC
TTTGCAGCACCTGCCTTTGGCCAGACTTCACAACCCGCGTCAGCTTTTGGTCAGCCTCAACAGTCGCAAATGCTC
TTTGGACAGGCTGCCCAAGCAAGCAACTCGCCTTTTGGCCAAGGTCCGAGTCCAGTATCTACCTTTGGCCAGCCA
TCCACGTTGGGAGCCAAGCCGAACCCTTTTGGAGCGCCGAGATTTGGCCAGCCAGCGTCACCAAGCACTCCGGGC
AATGCTTTTGGTCAGCCAGGCCAACAACACACTCAGGGCAGTCCCTTTGGCCAGGGCGCCCAGCAAAACACTCAG
GGCAGTCCTTTTGGTCAGGGCGCCCAGCAAAACACTCAGGCAAGTCCTTTTGGACAAATTGCACAGCAAAATACT
CAGGGCAGCCTATTTGGACAGCCGAGCCAACTCGGCCAGAGGCCGAGTATGTTTGCAGGTGCCTCGAATACAAAC
GCCTTTTCATCTCTAGGCAGTCAAAACAGCAACACCAACAATAATGCGCCAGCAGCAAATCCTTTTGGAAATGCC
AATGCTATCCAACAAAATCCCTTTGCAACAAACACACTCACTCCAACAACCATGGCGCCAAGTCCATTTGGACAG
GCAGTGCAGCAATCATCAAATCCATTTGGTCAGCAACAACAGTCTTCAGCTCCCAACCCATTTGGGCAAGCAACC
CCACAAGCATCATCAGCATTTGGGCAGATACAGCCCCCCCCCCAGACCAATGGGTTTGGGCAAGCAGCGAACAAT
TCTCTGCAAAACACTAATCAGCCGTTTGGCCAACCGGGCCTGCCACGCGCCAATCCCTTTGGCGCTCCTCAGACA
CAGCAAGCACAGCAATTACAGCAAGCACAGCAAACACAGCATGAGGCGCAGAACGCGTCAGAGAGCAGCCCATAT
CCTCCGGGAAGCTCCAAACAGCATCCACTCATTGCTACTTTCAGCTCCAAGGGCATGGATGGTAGACTGGCCTTG
TACAAGGGCAAGCCAGTTACATATGTGGACGACAAGCCAGTCGTCAGAAATTTGAACGGTACACTGTCTCGCATT
TGGTTTCCGGACGGAGCACCAGCATACACTTCGGATACGGAGCTTCCACCAGAAATGTATGACGAAAAAACAAGA
ACTCAATGGGAAGAATTCGCCTCGTCGGGAATTTTTACAGACGGCACCATGCCTGAGCTGCCGCCTCCCAGGGAG
TGTACGCGATGGGACTTTTGA
Transcript >OphauG2|4217
ATGACTATTTGCAAGTTTTGGGGGGCCGGCAACTGTCGCTATGGAAACAATTGCCGATTCGAGCACCCGACTCGA
ACCCAGCCTCAAAATCGATTTGGCACTGATGCCGTGTCGAAATTCAACAAGTACAACATAAGCGTCGAGCTTTTG
GAAAACGACTTGACGGCCGATTTGCCTGAATGGATTCTGTCGAGCTATGCTCCTGGCAAAAACGCACCCGAACAA
CTTTTTGGTGGCATCCAATGCGAGCAGAGCTTCGAAGAGCTTCGATTCATGCATATGCAGGCCCAGGCGGCGGGT
CATGAAGGGCAAGCCATTGCTGCCGCGCAAGAACTCTACCACGGCGCCAGAGGCCGAATAGACCATGCCTTGCGT
AATTCTCAAGACGCCGTGCAATTTGTCATTGATGGCGAAAACCGTCATCCCAATAGAAACGACGTTTGTCGCCAA
AGTTCTCATGGAGCGCCCTTTGGTGTTTTTGCTGTTGGCGTGCAACGTGGGCCCATGGCTCCAAAAAATTCTTCA
TTCGGCTTGGGAATCGCAGCTCAGCAAGGCAGCACTTTTGGCCAGCCCTCACTATTAGGCCAACGGCCCAATGCC
TTTGCAGCACCTGCCTTTGGCCAGACTTCACAACCCGCGTCAGCTTTTGGTCAGCCTCAACAGTCGCAAATGCTC
TTTGGACAGGCTGCCCAAGCAAGCAACTCGCCTTTTGGCCAAGGTCCGAGTCCAGTATCTACCTTTGGCCAGCCA
TCCACGTTGGGAGCCAAGCCGAACCCTTTTGGAGCGCCGAGATTTGGCCAGCCAGCGTCACCAAGCACTCCGGGC
AATGCTTTTGGTCAGCCAGGCCAACAACACACTCAGGGCAGTCCCTTTGGCCAGGGCGCCCAGCAAAACACTCAG
GGCAGTCCTTTTGGTCAGGGCGCCCAGCAAAACACTCAGGCAAGTCCTTTTGGACAAATTGCACAGCAAAATACT
CAGGGCAGCCTATTTGGACAGCCGAGCCAACTCGGCCAGAGGCCGAGTATGTTTGCAGGTGCCTCGAATACAAAC
GCCTTTTCATCTCTAGGCAGTCAAAACAGCAACACCAACAATAATGCGCCAGCAGCAAATCCTTTTGGAAATGCC
AATGCTATCCAACAAAATCCCTTTGCAACAAACACACTCACTCCAACAACCATGGCGCCAAGTCCATTTGGACAG
GCAGTGCAGCAATCATCAAATCCATTTGGTCAGCAACAACAGTCTTCAGCTCCCAACCCATTTGGGCAAGCAACC
CCACAAGCATCATCAGCATTTGGGCAGATACAGCCCCCCCCCCAGACCAATGGGTTTGGGCAAGCAGCGAACAAT
TCTCTGCAAAACACTAATCAGCCGTTTGGCCAACCGGGCCTGCCACGCGCCAATCCCTTTGGCGCTCCTCAGACA
CAGCAAGCACAGCAATTACAGCAAGCACAGCAAACACAGCATGAGGCGCAGAACGCGTCAGAGAGCAGCCCATAT
CCTCCGGGAAGCTCCAAACAGCATCCACTCATTGCTACTTTCAGCTCCAAGGGCATGGATGGTAGACTGGCCTTG
TACAAGGGCAAGCCAGTTACATATGTGGACGACAAGCCAGTCGTCAGAAATTTGAACGGTACACTGTCTCGCATT
TGGTTTCCGGACGGAGCACCAGCATACACTTCGGATACGGAGCTTCCACCAGAAATGTATGACGAAAAAACAAGA
ACTCAATGGGAAGAATTCGCCTCGTCGGGAATTTTTACAGACGGCACCATGCCTGAGCTGCCGCCTCCCAGGGAG
TGTACGCGATGGGACTTTTGA
Gene >OphauG2|4217
ATGACTATTTGCAAGTTTTGGGGGGCCGGCAACTGTCGCTATGGAAGTCAGTCACCCTTTGTTTTTTGCCTTTTT
CCCCAAACATGACGCTTACAACGCGTCTTTTCGCACTCGCAGACAATTGCCGATTCGAGCACCCGACTCGAACCC
AGCCTCAAAATCGATTTGGCACTGATGCCGTGTCGAAATTCAGTACGTAAATATTGTCTCTGGACACAAGCCCGG
TCCCATTTACCCAGCGCCCCGTTACTGACGAGGCCAAACTAGACAAGTACAACATAAGCGTCGAGCTTTTGGAAA
ACGACTTGACGGCCGATTTGCCTGAATGGATTCTGTCGAGCTATGCTCCTGGCAAAAACGCACCCGAACAACTTT
TTGGTGGCATCCAATGCGAGCAGAGCTTCGAAGAGCTTCGATTCATGCATATGCAGGCCCAGGCGGCGGGTCATG
AAGGGCAAGCCGTAAGTGCTAGCAAAGATTTTCAAGCAAACCAAAAAAAAAAAAAGAATTCACACGTGCTAACGA
GTGTGCAATAGATTGCTGCCGCGCAAGAACTCTACCACGGCGCCAGAGGCCGAATAGACCATGCCTTGCGTAATT
CTCAAGACGCCGTGCAATTTGTCATTGATGGCGAAAACCGTCATCCCAATAGAAACGACGTTTGTCGCCAAAGTT
CTCATGGAGCGCCCTTTGGTGTTTTTGCTGTTGGCGTGCAACGTGGGCCCATGGCTCCAAAAAATTCTTCATTCG
GCTTGGGAATCGCAGCTCAGCAAGGCAGCACTTTTGGCCAGCCCTCACTATTAGGCCAACGGCCCAATGCCTTTG
CAGCACCTGCCTTTGGCCAGACTTCACAACCCGCGTCAGCTTTTGGTCAGCCTCAACAGTCGCAAATGCTCTTTG
GACAGGCTGCCCAAGCAAGCAACTCGCCTTTTGGCCAAGGTCCGAGTCCAGTATCTACCTTTGGCCAGCCATCCA
CGTTGGGAGCCAAGCCGAACCCTTTTGGAGCGCCGAGATTTGGCCAGCCAGCGTCACCAAGCACTCCGGGCAATG
CTTTTGGTCAGCCAGGCCAACAACACACTCAGGGCAGTCCCTTTGGCCAGGGCGCCCAGCAAAACACTCAGGGCA
GTCCTTTTGGTCAGGGCGCCCAGCAAAACACTCAGGCAAGTCCTTTTGGACAAATTGCACAGCAAAATACTCAGG
GCAGCCTATTTGGACAGCCGAGCCAACTCGGCCAGAGGCCGAGTATGTTTGCAGGTGCCTCGAATACAAACGCCT
TTTCATCTCTAGGCAGTCAAAACAGCAACACCAACAATAATGCGCCAGCAGCAAATCCTTTTGGAAATGCCAATG
CTATCCAACAAAATCCCTTTGCAACAAACACACTCACTCCAACAACCATGGCGCCAAGTCCATTTGGACAGGCAG
TGCAGCAATCATCAAATCCATTTGGTCAGCAACAACAGTCTTCAGCTCCCAACCCATTTGGGCAAGCAACCCCAC
AAGCATCATCAGCATTTGGGCAGATACAGCCCCCCCCCCAGACCAATGGGTTTGGGCAAGCAGCGAACAATTCTC
TGCAAAACACTAATCAGCCGTTTGGCCAACCGGGCCTGCCACGCGCCAATCCCTTTGGCGCTCCTCAGACACAGC
AAGCACAGCAATTACAGCAAGCACAGCAAACACAGCATGAGGCGCAGAACGCGTCAGAGAGCAGCCCATATCCTC
CGGGAAGCTCCAAACAGCATCCACTCATTGCTACTTTCAGCTCCAAGGGCATGGATGGTAGACTGGCCTTGTACA
AGGGCAAGCCAGTTACATATGTGGACGACAAGCCAGTCGTCAGAAATTTGAACGGTACACTGTCTCGCATTTGGT
TTCCGGACGGAGCACCAGCATACACTTCGGATACGGAGCTTCCACCAGAAATGTATGACGAAAAAACAAGAACTC
AATGGGAAGAATTCGCCTCGTCGGGAATTTTTACAGACGGCACCATGCCTGAGCTGCCGCCTCCCAGGGAGTGTA
CGCGATGGGACTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail