Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4213
Gene name
LocationContig_343:9330..10712
Strand-
Gene length (bp)1382
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999641

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup870
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4213 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|208
Ophiocordyceps camponoti-floridani Ophcf2|07011
Ophiocordyceps camponoti-rufipedis Ophun1|667
Ophiocordyceps kimflemingae Ophio5|6686
Ophiocordyceps subramaniannii Hirsu2|4952
Ophiocordyceps subramaniannii Hirsu2|8371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4213
MMLKSAILLALASAVAAKRCREIVVPVDISSSNTVYDVATPRTEIDTTNFFLNLARQNSNYSATIAKGHRTIQGS
YKLATTYCEPDSGPGNAIQIMTHGIGFDRSYWDYGYQNNYYSYINRAVEHGYSTLTWDRLGIGHSTHLDAISEAQ
IFLEVAALGALTQHVRDGKICDVNHRFTKLVHVGHSFGSVMTFILTQMDPGVTDAIVLTGYSQRPDYMAEFVLGG
DFVPVSSLPMLGNKYSPGYVAPRTSVGVQTNFFAPGDFDAQMLKSATLNGQPAALGELLTLGAAGMMSGFGGAVQ
IVTGERDVPFCGGDCFNTKSIGASAPNLLESSRNNFANARNFSATVVPHAGHGLNFQYSCGVTYKAMLDFLHDNL
*
Coding >OphauG2|4213
ATGATGCTCAAATCGGCCATTTTGCTGGCGTTAGCGTCAGCCGTGGCGGCCAAGAGATGCCGAGAAATTGTTGTG
CCAGTCGACATTTCTTCAAGCAACACAGTCTATGATGTTGCTACGCCTCGGACTGAGATTGACACAACAAACTTC
TTTCTAAACCTCGCCAGGCAAAACTCTAATTACTCGGCAACGATTGCCAAGGGTCATAGGACGATTCAGGGCTCG
TACAAGCTAGCCACAACGTACTGCGAACCAGACAGTGGGCCCGGCAACGCCATCCAAATCATGACGCACGGAATC
GGCTTTGATCGGAGCTACTGGGACTACGGCTACCAAAACAACTACTACAGCTACATCAACCGCGCCGTTGAGCAC
GGCTACTCCACCCTGACCTGGGACCGGCTCGGCATCGGCCACTCGACTCACCTCGACGCCATTTCCGAGGCGCAA
ATCTTTCTCGAAGTCGCGGCTCTTGGCGCCCTGACCCAACATGTGCGCGACGGAAAGATTTGCGACGTCAACCAC
CGCTTCACCAAACTCGTCCACGTCGGCCATTCCTTTGGCTCCGTCATGACATTTATCCTGACGCAAATGGACCCC
GGCGTCACAGACGCCATTGTCCTAACCGGCTACAGCCAACGCCCAGACTACATGGCGGAGTTTGTGCTCGGCGGC
GACTTTGTCCCAGTCTCGAGTCTGCCGATGCTGGGAAACAAGTACTCGCCTGGATACGTGGCGCCAAGGACCAGC
GTCGGCGTCCAGACCAACTTTTTTGCGCCGGGCGACTTTGATGCGCAGATGCTGAAAAGCGCCACCTTGAATGGC
CAGCCTGCTGCTCTGGGCGAGCTGCTGACCCTTGGCGCGGCGGGAATGATGAGTGGCTTTGGTGGCGCGGTGCAG
ATTGTCACTGGGGAACGAGATGTTCCCTTTTGCGGAGGCGACTGCTTCAACACAAAATCAATTGGAGCTTCAGCG
CCAAACCTCCTCGAAAGCTCGAGAAACAACTTTGCAAACGCGCGCAACTTTAGTGCCACCGTGGTGCCCCATGCC
GGCCACGGTCTCAACTTTCAATACTCGTGTGGCGTCACCTACAAAGCCATGCTCGACTTTCTCCATGACAACCTG
TGA
Transcript >OphauG2|4213
ATGATGCTCAAATCGGCCATTTTGCTGGCGTTAGCGTCAGCCGTGGCGGCCAAGAGATGCCGAGAAATTGTTGTG
CCAGTCGACATTTCTTCAAGCAACACAGTCTATGATGTTGCTACGCCTCGGACTGAGATTGACACAACAAACTTC
TTTCTAAACCTCGCCAGGCAAAACTCTAATTACTCGGCAACGATTGCCAAGGGTCATAGGACGATTCAGGGCTCG
TACAAGCTAGCCACAACGTACTGCGAACCAGACAGTGGGCCCGGCAACGCCATCCAAATCATGACGCACGGAATC
GGCTTTGATCGGAGCTACTGGGACTACGGCTACCAAAACAACTACTACAGCTACATCAACCGCGCCGTTGAGCAC
GGCTACTCCACCCTGACCTGGGACCGGCTCGGCATCGGCCACTCGACTCACCTCGACGCCATTTCCGAGGCGCAA
ATCTTTCTCGAAGTCGCGGCTCTTGGCGCCCTGACCCAACATGTGCGCGACGGAAAGATTTGCGACGTCAACCAC
CGCTTCACCAAACTCGTCCACGTCGGCCATTCCTTTGGCTCCGTCATGACATTTATCCTGACGCAAATGGACCCC
GGCGTCACAGACGCCATTGTCCTAACCGGCTACAGCCAACGCCCAGACTACATGGCGGAGTTTGTGCTCGGCGGC
GACTTTGTCCCAGTCTCGAGTCTGCCGATGCTGGGAAACAAGTACTCGCCTGGATACGTGGCGCCAAGGACCAGC
GTCGGCGTCCAGACCAACTTTTTTGCGCCGGGCGACTTTGATGCGCAGATGCTGAAAAGCGCCACCTTGAATGGC
CAGCCTGCTGCTCTGGGCGAGCTGCTGACCCTTGGCGCGGCGGGAATGATGAGTGGCTTTGGTGGCGCGGTGCAG
ATTGTCACTGGGGAACGAGATGTTCCCTTTTGCGGAGGCGACTGCTTCAACACAAAATCAATTGGAGCTTCAGCG
CCAAACCTCCTCGAAAGCTCGAGAAACAACTTTGCAAACGCGCGCAACTTTAGTGCCACCGTGGTGCCCCATGCC
GGCCACGGTCTCAACTTTCAATACTCGTGTGGCGTCACCTACAAAGCCATGCTCGACTTTCTCCATGACAACCTG
TGA
Gene >OphauG2|4213
ATGATGCTCAAATCGGCCATTTTGCTGGCGTTAGCGTCAGCCGTGGCGGCCAAGAGATGCCGAGAAATTGTTGTG
CCAGTCGACATTTCTTCAAGCAACACAGTCTATGATGTTGCTACGCCTCGGACTGAGATTGACACAACAAACTTC
TTTCTAAACCTCGCCAGGCAAAACTCTAATTACTCGGCAACGATTGCCAAGGGTGTAAGTGGAGCTTCTTGCTCA
GAGTCGAGAGAAAGAAGATGGAGCAAAAAAAAAGGAGTTGTGACGAGAACTAAAATATAGACAAAATGAGACAAA
ATGATATCCAACTGACATACTTTTGGACGGCAGCATAGGACGATTCAGGGCTCGTACAAGCTAGCCACAACGTAC
TGCGAACCAGACAGTGGGCCCGGCAACGCCATCCAAATCATGACGCACGGAATCGGCTTTGATCGGAGCTACTGG
GACTACGGCTACCAAAACAACTACTACAGCTACATCAACCGCGCCGTTGAGCACGGCTACTCCACCCTGACCTGG
GACCGGCTCGGCATCGGCCACTCGACTCACCTCGACGCCATTTCCGAGGCGCAAATCTTTCTCGAAGTCGCGGCT
CTTGGCGCCCTGACCCAACATGTGCGCGACGGAAAGATTTGCGACGTCAACCACCGCTTCACCAAACTCGTCCAC
GTCGGCCATTCCTTTGGCTCCGTCATGACATTTATCCTGACGCAAATGGACCCCGGCGTCACAGACGCCATTGTC
CTAACCGGCTACAGCCAACGCCCAGACTACATGGCGGAGTTTGTGCTCGGCGGCGACTTTGTCCCAGTCTCGAGT
CTGCCGATGCTGGGAAACAAGTACTCGCCTGGATACGTGGCGCCAAGGACCAGCGTCGGCGTCCAGACCAACTTT
TTTGCGCCGGGCGACTTTGATGCGCAGATGCTGAAAAGCGCCACCTTGAATGGCCAGCCTGCTGCTCTGGGCGAG
CTGCTGACCCTTGGCGCGGCGGGAATGATGAGTGGCTTTGGTGGCGCGGTGCAGATTGTCACTGGGGGTGAGTCT
CCAAAAAAAAAAAAAAANNNNNNNNNNNNNNNNNNNNNNNNAAAAAAAAAAACTTGCCATGCCTCCCAACCTCCT
TGGTATTCGTTGAATAAGAGGCTGATTTTCCCGCCTGTCTAGAACGAGATGTTCCCTTTTGCGGAGGCGACTGCT
TCAACACAAAATCAATTGGAGCTTCAGCGCCAAACCTCCTCGAAAGCTCGAGAAACAACTTTGCAAACGCGCGCA
ACTTTAGTGCCACCGTGGTGCCCCATGCCGGCCACGGTCTCAACTTTCAATACTCGTGTGGCGTCACCTACAAAG
CCATGCTCGACTTTCTCCATGACAACCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail