Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4208
Gene name
LocationContig_342:15584..17540
Strand+
Gene length (bp)1956
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 6.5E-23 79 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 58 501 3.0E-47
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 72 522 6.0E-36
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 77 248 9.0E-17
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 74 277 2.0E-11
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 79 243 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 58 501 3.0E-47
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 72 522 6.0E-36
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 77 248 9.0E-17
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 74 277 2.0E-11
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 79 243 3.0E-11
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 79 255 4.0E-11
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 89 246 9.0E-10
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 76 243 2.0E-09
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 78 243 4.0E-09
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 143 229 5.0E-09
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 104 251 2.0E-08
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 73 243 2.0E-08
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 73 243 2.0E-08
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 78 243 3.0E-08
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 58 243 6.0E-08
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 72 243 2.0E-07
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 76 243 3.0E-06
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 46 265 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4208
MRFFLSAAAWAAGSLLVKGVTCKLADDVEFVCDALASKHPDHLIWDPIGPRGAETVMDASIYNRVLVDYWNAASA
GNRPACTFVPETAEQVSLAVKLLGENSDVRFALKGGGHNPNLGFSSVKEGVLISFRPNMMQAVPSSDGSWIEVGA
GCKWEQLYEVLDPLGKSVVGGRLGDVGIMGFILGGGLSYLSAQYGFACDNVIEFECVTANGDILTATPRENSDLW
WALRGGGNQYAVVTRMKLKTHDVGDKGTVWGGVRTYAAIHHARLLSAIAKFTSSDSDPKAAIIPTFNFPSGLGLT
APPAIIVFFQYDAARPMTDVFADFDAIPAITDDTRPQTTSSLTREVLGGNYKGLRFQIRENTFPSMPREPMEEFL
SEHYHRAARIAAEGAVRDPADFRLFSFAIQPMPRTIANASIMTGGGNAMGLHPEHGDRIWIEYDLAWLNPSCDSR
CPRFFRREVEKLRDYHRREFANIPPTNYMSGQLSYVCYNPIFMNDAMEDQDPLVSYGRGNYFRLRAIKMKYDKYD
FLGRQQLGFRFRSRPWKLR*
Coding >OphauG2|4208
ATGCGTTTCTTTCTCTCCGCCGCCGCGTGGGCAGCAGGGAGCCTCCTGGTCAAAGGAGTAACATGCAAGTTGGCC
GACGATGTTGAATTCGTTTGCGATGCCCTCGCCTCAAAGCACCCCGACCACCTCATTTGGGATCCCATCGGACCC
CGGGGGGCCGAGACGGTAATGGACGCCAGCATCTACAACCGCGTCCTGGTCGACTACTGGAACGCGGCCAGCGCA
GGCAACAGGCCGGCATGTACCTTTGTGCCGGAAACAGCTGAGCAAGTGTCGCTGGCCGTCAAGCTGCTAGGCGAA
AACAGCGACGTGCGGTTTGCTCTCAAGGGCGGCGGCCACAATCCGAATCTGGGCTTCTCGAGCGTAAAAGAGGGC
GTCTTGATTTCCTTTCGGCCAAACATGATGCAGGCCGTTCCGTCGAGCGATGGATCGTGGATCGAGGTCGGGGCG
GGATGCAAGTGGGAGCAGCTGTACGAGGTGCTGGATCCCTTGGGCAAGTCTGTGGTGGGCGGCCGGCTGGGTGAT
GTGGGCATCATGGGCTTTATTCTCGGGGGCGGCTTGTCGTATCTGTCGGCCCAGTACGGGTTTGCCTGCGACAAT
GTCATCGAGTTTGAATGCGTCACGGCAAACGGCGACATCCTCACGGCCACGCCTCGCGAAAACTCTGATCTCTGG
TGGGCTCTCCGCGGCGGCGGCAACCAATACGCCGTGGTGACGCGCATGAAGCTCAAGACGCACGACGTGGGCGAC
AAGGGCACGGTCTGGGGCGGCGTACGCACCTATGCCGCCATCCACCACGCTCGCCTCTTGTCGGCCATTGCAAAG
TTCACCAGCAGCGACAGCGACCCCAAAGCGGCCATTATCCCGACCTTCAACTTCCCCAGCGGCCTGGGCCTCACT
GCCCCGCCCGCCATCATCGTCTTCTTCCAGTACGATGCCGCCCGCCCCATGACCGACGTCTTTGCCGACTTTGAC
GCCATTCCCGCAATCACCGACGACACGCGCCCGCAGACCACGTCCAGCCTCACGCGCGAGGTGCTGGGCGGCAAC
TACAAGGGCCTGCGCTTCCAGATCCGCGAAAACACCTTTCCCAGCATGCCGCGCGAGCCCATGGAGGAGTTTCTC
AGCGAGCACTACCACCGCGCGGCAAGAATCGCAGCCGAGGGCGCCGTTCGCGACCCTGCCGACTTTCGCCTCTTT
TCCTTTGCCATCCAGCCCATGCCGCGGACCATTGCCAATGCCTCAATCATGACTGGAGGAGGCAATGCCATGGGC
CTTCATCCCGAGCACGGCGACCGCATTTGGATAGAGTACGACTTGGCCTGGTTGAATCCCTCGTGCGACTCGAGG
TGTCCGCGCTTCTTTAGGCGCGAGGTGGAGAAGCTGCGTGACTATCACCGCCGCGAATTTGCCAACATTCCGCCT
ACAAATTACATGAGCGGACAATTGAGCTATGTCTGCTACAATCCCATCTTCATGAATGACGCCATGGAAGACCAA
GATCCCCTCGTCAGCTACGGAAGAGGAAACTACTTTCGACTAAGAGCCATCAAGATGAAGTATGACAAGTACGAC
TTTTTGGGCAGACAGCAACTCGGCTTCCGCTTTCGCTCAAGGCCTTGGAAGCTGAGGTGA
Transcript >OphauG2|4208
ATGCGTTTCTTTCTCTCCGCCGCCGCGTGGGCAGCAGGGAGCCTCCTGGTCAAAGGAGTAACATGCAAGTTGGCC
GACGATGTTGAATTCGTTTGCGATGCCCTCGCCTCAAAGCACCCCGACCACCTCATTTGGGATCCCATCGGACCC
CGGGGGGCCGAGACGGTAATGGACGCCAGCATCTACAACCGCGTCCTGGTCGACTACTGGAACGCGGCCAGCGCA
GGCAACAGGCCGGCATGTACCTTTGTGCCGGAAACAGCTGAGCAAGTGTCGCTGGCCGTCAAGCTGCTAGGCGAA
AACAGCGACGTGCGGTTTGCTCTCAAGGGCGGCGGCCACAATCCGAATCTGGGCTTCTCGAGCGTAAAAGAGGGC
GTCTTGATTTCCTTTCGGCCAAACATGATGCAGGCCGTTCCGTCGAGCGATGGATCGTGGATCGAGGTCGGGGCG
GGATGCAAGTGGGAGCAGCTGTACGAGGTGCTGGATCCCTTGGGCAAGTCTGTGGTGGGCGGCCGGCTGGGTGAT
GTGGGCATCATGGGCTTTATTCTCGGGGGCGGCTTGTCGTATCTGTCGGCCCAGTACGGGTTTGCCTGCGACAAT
GTCATCGAGTTTGAATGCGTCACGGCAAACGGCGACATCCTCACGGCCACGCCTCGCGAAAACTCTGATCTCTGG
TGGGCTCTCCGCGGCGGCGGCAACCAATACGCCGTGGTGACGCGCATGAAGCTCAAGACGCACGACGTGGGCGAC
AAGGGCACGGTCTGGGGCGGCGTACGCACCTATGCCGCCATCCACCACGCTCGCCTCTTGTCGGCCATTGCAAAG
TTCACCAGCAGCGACAGCGACCCCAAAGCGGCCATTATCCCGACCTTCAACTTCCCCAGCGGCCTGGGCCTCACT
GCCCCGCCCGCCATCATCGTCTTCTTCCAGTACGATGCCGCCCGCCCCATGACCGACGTCTTTGCCGACTTTGAC
GCCATTCCCGCAATCACCGACGACACGCGCCCGCAGACCACGTCCAGCCTCACGCGCGAGGTGCTGGGCGGCAAC
TACAAGGGCCTGCGCTTCCAGATCCGCGAAAACACCTTTCCCAGCATGCCGCGCGAGCCCATGGAGGAGTTTCTC
AGCGAGCACTACCACCGCGCGGCAAGAATCGCAGCCGAGGGCGCCGTTCGCGACCCTGCCGACTTTCGCCTCTTT
TCCTTTGCCATCCAGCCCATGCCGCGGACCATTGCCAATGCCTCAATCATGACTGGAGGAGGCAATGCCATGGGC
CTTCATCCCGAGCACGGCGACCGCATTTGGATAGAGTACGACTTGGCCTGGTTGAATCCCTCGTGCGACTCGAGG
TGTCCGCGCTTCTTTAGGCGCGAGGTGGAGAAGCTGCGTGACTATCACCGCCGCGAATTTGCCAACATTCCGCCT
ACAAATTACATGAGCGGACAATTGAGCTATGTCTGCTACAATCCCATCTTCATGAATGACGCCATGGAAGACCAA
GATCCCCTCGTCAGCTACGGAAGAGGAAACTACTTTCGACTAAGAGCCATCAAGATGAAGTATGACAAGTACGAC
TTTTTGGGCAGACAGCAACTCGGCTTCCGCTTTCGCTCAAGGCCTTGGAAGCTGAGGTGA
Gene >OphauG2|4208
ATGCGTTTCTTTCTCTCCGCCGCCGCGTGGGCAGCAGGGAGCCTCCTGGTCAAAGGAGTAACATGCAAGTTGGCC
GACGATGTTGAATTCGTTTGCGATGCCCTCGCCTCAAAGCACCCCGACCACCTCATTTGGGATCCCATCGGACCC
CGGGGGGCCGAGACGGTAATGGACGCCAGCATCTACAACCGCGTCCTGGTCGACTACTGGAACGCGGCCAGCGCA
GGCAACAGGCCGGCATGTACCTTTGTGCCGGAAACAGCTGAGCAAGTGTCGCTGGCCGTCAAGCTGCTAGGCGAA
AACAGCGACGTGCGGTTTGCTCTCAAGGGCGGCGGCCACAATCCGAATCTGGGCTTCTCGAGCGTAAAAGAGGGC
GTCTTGATTTCCTTTCGGCCAAACATGATGCAGGCCGTTCCGTCGAGCGATGGATCGTGGATCGAGGTCGGGGCG
GGATGCAAGTGGGAGCAGCTGTACGAGGTGCTGGATCCCTTGGGCAAGTCTGTGGTGGGCGGCCGGCTGGGTGAT
GTGGGCATCATGGGCTTTATTCTCGGGGGCGGCTTGTCGTATCTGTCGGCCCAGTACGTGAGTATAGCAGTCCTG
TCATTATCCGAGTCCCCGCCTTGTATTGCCGAGCTCCATCGTTTCTCCATCCTCGGCCTGTATTCTCGAGCTCTG
CTTCTTCTCCGTCCGCTACTCTCCATCGTCATCTACTTGCACGCCTCATCATGGGCACATGTCGAGGGCAAAAAT
CAAAAAAAGCTAACCATGGCCCAAGGGGTTTGCCTGCGACAATGTCATCGAGTTTGAATGCGTCACGGCAAACGG
CGACATCCTCACGGCCACGCCTCGCGAAAACTCTGATCTCTGGTGGGCTCTCCGCGGCGGCGGCAACCAATACGC
CGTGGTGACGCGCATGAAGCTCAAGACGCACGACGTGGGCGACAAGGGCACGGTCTGGGGCGGCGTACGCACCTA
TGCCGCCATCCACCACGCTCGCCTCTTGTCGGCCATTGCAAAGTTCACCAGCAGCGACAGCGACCCCAAAGCGGC
CATTATCCCGACCTTCAACTTCCCCAGCGGCCTGGGCCTCACTGCCCCGCCCGCCATCATCGTCTTCTTCCAGTA
CGATGCCGCCCGCCCCATGACCGACGTCTTTGCCGACTTTGACGCCATTCCCGCAATCACCGACGACACGCGCCC
GCAGACCACGTCCAGCCTCACGCGCGAGGTGCTGGGCGGCAACTACAAGGGCCTGCGCTTCCAGATCCGCGAAAA
CACCTTTCCCAGCATGCCGCGCGAGCCCATGGAGGAGTTTCTCAGCGAGCACTACCACCGCGCGGCAAGAATCGC
AGCCGAGGGCGCCGTTCGCGACCCTGCCGACTTTCGCCTCTTTTCCTTTGCCATCCAGCCCATGCCGCGGACCAT
TGCCAATGCCTCAATCATGACTGGAGGAGGCAATGCCATGGGCCTTCATCCCGAGCACGGCGACCGCATTTGGAT
AGAGTACGACTTGGCCTGGTTGAATCCCTCGTGCGACTCGAGGTGTCCGCGCTTCTTTAGGCGCGAGGTGGAGAA
GCTGCGTGACTATCACCGCCGCGAATTTGCCAACATTCCGCCTACAAATTACATGAGCGGACAATTGAGCTATGT
CTGGTAAGTCGTCATGGTGTTTTTCTGTTGTTGTTTTTTTGTTCTTTTTGTTTTTTTTTGTTTTTTTTTTTTTCT
TGCTTGTTTTTTTTGCTTCTTCCCGTGTTCCGGTCCGCAGCAACTGACAGGCATAGCTACAATCCCATCTTCATG
AATGACGCCATGGAAGACCAAGATCCCCTCGTCAGCTACGGAAGAGGAAACTACTTTCGACTAAGAGCCATCAAG
ATGAAGTATGACAAGTACGACTTTTTGGGCAGACAGCAACTCGGCTTCCGCTTTCGCTCAAGGCCTTGGAAGCTG
AGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail