Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4197
Gene name
LocationContig_341:496..1461
Strand+
Gene length (bp)965
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14413 Thg1C Thg1 C terminal domain 4.7E-52 75 202
PF04446 Thg1 tRNAHis guanylyltransferase 1.6E-23 2 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDM8|THG1_NEUCR tRNA(His) guanylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgt-1 PE=3 SV=1 1 223 1.0E-109
sp|Q6BKD4|THG1_DEBHA tRNA(His) guanylyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=THG1 PE=3 SV=2 2 213 3.0E-75
sp|Q9CY52|THG1_MOUSE Probable tRNA(His) guanylyltransferase OS=Mus musculus GN=Thg1l PE=1 SV=1 1 216 8.0E-68
sp|Q05B50|THG1_BOVIN Probable tRNA(His) guanylyltransferase OS=Bos taurus GN=THG1L PE=2 SV=1 1 213 2.0E-66
sp|Q5M965|THG1_RAT Probable tRNA(His) guanylyltransferase OS=Rattus norvegicus GN=Thg1l PE=2 SV=1 1 216 3.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDM8|THG1_NEUCR tRNA(His) guanylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgt-1 PE=3 SV=1 1 223 1.0E-109
sp|Q6BKD4|THG1_DEBHA tRNA(His) guanylyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=THG1 PE=3 SV=2 2 213 3.0E-75
sp|Q9CY52|THG1_MOUSE Probable tRNA(His) guanylyltransferase OS=Mus musculus GN=Thg1l PE=1 SV=1 1 216 8.0E-68
sp|Q05B50|THG1_BOVIN Probable tRNA(His) guanylyltransferase OS=Bos taurus GN=THG1L PE=2 SV=1 1 213 2.0E-66
sp|Q5M965|THG1_RAT Probable tRNA(His) guanylyltransferase OS=Rattus norvegicus GN=Thg1l PE=2 SV=1 1 216 3.0E-66
sp|Q9NWX6|THG1_HUMAN Probable tRNA(His) guanylyltransferase OS=Homo sapiens GN=THG1L PE=1 SV=2 1 213 1.0E-64
sp|Q9Y7T3|THG1_SCHPO tRNA(His) guanylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thg1 PE=3 SV=1 3 212 1.0E-61
sp|Q54E29|THG1_DICDI Probable tRNA(His) guanylyltransferase OS=Dictyostelium discoideum GN=thg1 PE=3 SV=1 1 216 3.0E-59
sp|Q9V3N8|THG1_DROME Probable tRNA(His) guanylyltransferase OS=Drosophila melanogaster GN=l(2)35Bc PE=2 SV=1 3 168 4.0E-55
sp|P53215|THG1_YEAST tRNA(His) guanylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THG1 PE=1 SV=1 3 156 6.0E-54
sp|Q6FPX3|THG1_CANGA tRNA(His) guanylyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=THG1 PE=3 SV=1 3 156 1.0E-52
sp|Q75DJ3|THG1_ASHGO tRNA(His) guanylyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=THG1 PE=3 SV=1 3 156 5.0E-51
sp|Q6CW75|THG1_KLULA tRNA(His) guanylyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=THG1 PE=3 SV=1 3 156 1.0E-50
sp|F4IRQ5|THG1_ARATH tRNA(His) guanylyltransferase 1 OS=Arabidopsis thaliana GN=THG1 PE=1 SV=1 3 214 2.0E-48
sp|F4ISV6|THG2_ARATH tRNA(His) guanylyltransferase 2 OS=Arabidopsis thaliana GN=THG2 PE=1 SV=1 3 214 3.0E-47
sp|F4IRQ5|THG1_ARATH tRNA(His) guanylyltransferase 1 OS=Arabidopsis thaliana GN=THG1 PE=1 SV=1 1 151 2.0E-38
sp|F4ISV6|THG2_ARATH tRNA(His) guanylyltransferase 2 OS=Arabidopsis thaliana GN=THG2 PE=1 SV=1 2 151 7.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0008193 tRNA guanylyltransferase activity Yes
GO:0006400 tRNA modification Yes
GO:0006399 tRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0034660 ncRNA metabolic process No
GO:0006396 RNA processing No
GO:0008192 RNA guanylyltransferase activity No
GO:0009451 RNA modification No
GO:0043412 macromolecule modification No
GO:0008033 tRNA processing No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0070568 guanylyltransferase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:0043169 cation binding No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2810
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4197 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4437
Ophiocordyceps camponoti-floridani Ophcf2|03361
Ophiocordyceps camponoti-rufipedis Ophun1|5672
Ophiocordyceps kimflemingae Ophio5|2252
Ophiocordyceps subramaniannii Hirsu2|4524

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4197
MPDITIGYGISDEYSFVFHRSCSLFERRASKLVSTVVSTFTANYVYSWSTYFPDTPLTFPLPTFDGRSVCYPSVQ
NLRDYLSWRQVDCHINNLYNTTFWALVQLGGLNNKEAEKTLTGTYAADKNEILFSRFHINYNNEPEMFKKGSVIF
RDYELVDPSAHKPACDAHAISEPAPQSKSQAEKEQKRRAKARVVVEHLDIIKDDFWDRRPWILSNKPGKVPKET*
Coding >OphauG2|4197
ATGCCCGACATCACGATTGGCTACGGCATCAGCGACGAATACAGCTTCGTCTTTCACAGGTCGTGTAGTCTCTTT
GAGCGGAGGGCAAGCAAGCTCGTCAGCACCGTCGTCTCAACCTTTACAGCCAACTATGTTTACTCTTGGTCCACC
TACTTTCCCGATACTCCCCTGACCTTTCCCTTGCCGACGTTTGATGGCCGGTCTGTATGCTATCCCAGTGTGCAA
AATCTGCGCGACTACCTGAGCTGGCGGCAGGTTGACTGCCATATCAACAATCTCTACAACACCACTTTTTGGGCA
CTTGTACAACTTGGAGGTCTTAATAATAAAGAGGCCGAGAAAACCCTGACGGGAACGTATGCCGCTGATAAAAAC
GAAATTCTTTTTTCACGGTTCCACATCAACTACAACAACGAGCCTGAAATGTTCAAAAAGGGCAGCGTCATCTTT
CGAGACTATGAGCTCGTCGATCCTAGTGCCCACAAGCCAGCATGCGATGCCCATGCGATATCTGAGCCAGCACCG
CAGTCAAAAAGCCAAGCAGAAAAGGAACAGAAGCGAAGAGCCAAAGCCAGAGTGGTTGTGGAGCATCTGGACATC
ATCAAGGACGATTTTTGGGATAGACGGCCGTGGATCCTGTCCAACAAGCCAGGAAAGGTGCCCAAAGAAACATAA
Transcript >OphauG2|4197
ATGCCCGACATCACGATTGGCTACGGCATCAGCGACGAATACAGCTTCGTCTTTCACAGGTCGTGTAGTCTCTTT
GAGCGGAGGGCAAGCAAGCTCGTCAGCACCGTCGTCTCAACCTTTACAGCCAACTATGTTTACTCTTGGTCCACC
TACTTTCCCGATACTCCCCTGACCTTTCCCTTGCCGACGTTTGATGGCCGGTCTGTATGCTATCCCAGTGTGCAA
AATCTGCGCGACTACCTGAGCTGGCGGCAGGTTGACTGCCATATCAACAATCTCTACAACACCACTTTTTGGGCA
CTTGTACAACTTGGAGGTCTTAATAATAAAGAGGCCGAGAAAACCCTGACGGGAACGTATGCCGCTGATAAAAAC
GAAATTCTTTTTTCACGGTTCCACATCAACTACAACAACGAGCCTGAAATGTTCAAAAAGGGCAGCGTCATCTTT
CGAGACTATGAGCTCGTCGATCCTAGTGCCCACAAGCCAGCATGCGATGCCCATGCGATATCTGAGCCAGCACCG
CAGTCAAAAAGCCAAGCAGAAAAGGAACAGAAGCGAAGAGCCAAAGCCAGAGTGGTTGTGGAGCATCTGGACATC
ATCAAGGACGATTTTTGGGATAGACGGCCGTGGATCCTGTCCAACAAGCCAGGAAAGGTGCCCAAAGAAACATAA
Gene >OphauG2|4197
ATGCCCGACATCACGATTGGCTACGGCATCAGCGACGAATACAGGTAACGATGAAGCCTAGAAACTTTGTACCGC
TGACTTTATAGTCTCACCATGCACGCGCAGCTTCGTCTTTCACAGGTCGTGTAGTCTCTTTGAGCGGAGGGCAAG
GTTGGTTGTTTCTGCTTTAACCATTATCTGCCAGTCCCTTGGTTCATGACTTGTAGCAAGCTCGTCAGCACCGTC
GTCTCAACCTTTACAGCCAACTATGTTTACTCTTGGTCCACCTACTTTCCCGATACTCCCCTGACCTTTCCCTTG
CCGACGTTTGATGGCCGGTCTGTATGCTATCCCAGTGTGCAAAATCTGCGCGACTACCTGAGCTGGCGGCAGGTT
GACTGTAAGTCTCCAACTCTTACCACCTTTTCCTCTGCGTCGAGCTAAGCGTTGGAGGCCATATCAACAATCTCT
ACAACACCACTTTTTGGGCACTTGTACAACTTGGAGGTCTTAATAATAAAGAGGCCGAGAAAACCCTGACGGTGT
GTGCCCAGAGCTACTTGGTTTGGTTTGTTTTGCTCCAAGACAATTAATCTGGCTCATACAGGGAACGTATGCCGC
TGATAAAAACGAAATTCTTTTTTCACGGTTCCACATCAACTACAACAACGAGCCTGAAATGTTCAAAAAGGGCAG
CGTCATCTTTCGAGACGTGAGTCTGGCGCGCCCCCGTTTTGATGTAGAGAGACCTGACTGTGATGCTTTAGTATG
AGCTCGTCGATCCTAGTGCCCACAAGCCAGCATGCGATGCCCATGCGATATCTGAGCCAGCACCGCAGTCAAAAA
GCCAAGCAGAAAAGGAACAGAAGCGAAGAGCCAAAGCCAGAGTGGTTGTGGAGCATCTGGACATCATCAAGGACG
ATTTTTGGGATAGACGGCCGTGGATCCTGTCCAACAAGCCAGGAAAGGTGCCCAAAGAAACATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail