Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4196
Gene name
LocationContig_340:16880..17960
Strand+
Gene length (bp)1080
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16455 UBD Ubiquitin-binding domain 5.6E-38 60 171
PF00240 ubiquitin Ubiquitin family 2.1E-06 240 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4V8W7|UBTD1_DANRE Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1 60 304 6.0E-10
sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rattus norvegicus GN=Ubtd1 PE=2 SV=1 47 304 3.0E-08
sp|Q91WB7|UBTD1_MOUSE Ubiquitin domain-containing protein 1 OS=Mus musculus GN=Ubtd1 PE=2 SV=1 47 304 6.0E-08
sp|Q9HAC8|UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens GN=UBTD1 PE=1 SV=1 47 304 6.0E-08
sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=Bos taurus GN=UBTD1 PE=2 SV=1 47 304 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4V8W7|UBTD1_DANRE Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1 60 304 6.0E-10
sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rattus norvegicus GN=Ubtd1 PE=2 SV=1 47 304 3.0E-08
sp|Q91WB7|UBTD1_MOUSE Ubiquitin domain-containing protein 1 OS=Mus musculus GN=Ubtd1 PE=2 SV=1 47 304 6.0E-08
sp|Q9HAC8|UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens GN=UBTD1 PE=1 SV=1 47 304 6.0E-08
sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=Bos taurus GN=UBTD1 PE=2 SV=1 47 304 2.0E-07
sp|Q9HDW4|YFW7_SCHPO Uncharacterized protein PB2B4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB2B4.07 PE=1 SV=1 63 303 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4401
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4196 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8077
Ophiocordyceps camponoti-floridani Ophcf2|04717
Ophiocordyceps camponoti-rufipedis Ophun1|6402
Ophiocordyceps kimflemingae Ophio5|6181
Ophiocordyceps subramaniannii Hirsu2|9110

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4196
MGCCFSSTAGSSSSFPDSGPNASSRRISSASLNRSERPGSQTCSTRRRRRDTGALDQHIDKPLRRHEWTSKDRRW
TRSQLDAERAAFFDTRVTGRPEIWQTIRAALSVLTHPDTDDDAAEIDGLATAQSILSAAEISLPTGDLVNGAYDS
LGNFYQMHAWLVADPTNLAHDDEDHDDDSGDDAESHRSLSPTRKQSILRTDHDDDAELSSSDSIDKRRREKGKAV
LDMRDHLSVRARLSDSGRDVNVSVRKSDAGRTVIRAIVSESALPPSKKIRLAYMGKMLRDDLTLESQGWQTGHVI
NALVFPR*
Coding >OphauG2|4196
ATGGGCTGCTGCTTCTCCTCAACAGCGGGCTCAAGCTCGTCGTTTCCCGACAGTGGCCCTAATGCCTCGTCTCGT
CGCATCAGCTCCGCCTCGCTGAATCGCTCAGAGCGCCCCGGCTCGCAGACTTGCTCGACGCGCCGCCGCCGCAGA
GACACGGGGGCCCTTGATCAGCACATTGACAAGCCTCTGCGTCGCCATGAGTGGACGAGCAAGGACCGCCGCTGG
ACGCGCAGCCAACTGGATGCCGAGCGCGCTGCGTTTTTTGACACGCGCGTCACTGGCCGCCCTGAGATATGGCAG
ACGATTCGCGCTGCTCTAAGCGTCTTGACCCATCCAGACACTGACGATGATGCCGCCGAGATTGATGGTCTTGCC
ACGGCTCAGTCTATTCTCTCGGCTGCCGAGATTTCTCTGCCCACTGGCGACTTGGTCAATGGCGCCTACGACTCC
CTGGGCAACTTTTACCAGATGCATGCGTGGCTTGTTGCTGATCCGACAAACCTGGCTCATGACGATGAGGATCAC
GACGATGACTCAGGTGATGACGCTGAGAGCCATCGCAGCTTGTCTCCTACCCGCAAGCAATCAATCCTCAGAACA
GACCATGACGACGACGCCGAGCTCTCCTCGTCTGATAGCATCGACAAGAGGCGGCGAGAAAAGGGCAAGGCTGTT
CTCGATATGCGTGACCATTTATCGGTCCGTGCCCGTCTTAGCGACTCGGGCCGCGATGTCAACGTCTCGGTTCGC
AAATCAGATGCTGGCCGCACCGTCATCAGAGCCATTGTTTCTGAATCTGCGCTGCCTCCTAGCAAAAAGATACGC
CTGGCCTACATGGGCAAAATGCTTCGCGACGACTTGACACTCGAATCCCAAGGCTGGCAGACGGGTCACGTCATC
AATGCCCTCGTCTTCCCGAGATAG
Transcript >OphauG2|4196
ATGGGCTGCTGCTTCTCCTCAACAGCGGGCTCAAGCTCGTCGTTTCCCGACAGTGGCCCTAATGCCTCGTCTCGT
CGCATCAGCTCCGCCTCGCTGAATCGCTCAGAGCGCCCCGGCTCGCAGACTTGCTCGACGCGCCGCCGCCGCAGA
GACACGGGGGCCCTTGATCAGCACATTGACAAGCCTCTGCGTCGCCATGAGTGGACGAGCAAGGACCGCCGCTGG
ACGCGCAGCCAACTGGATGCCGAGCGCGCTGCGTTTTTTGACACGCGCGTCACTGGCCGCCCTGAGATATGGCAG
ACGATTCGCGCTGCTCTAAGCGTCTTGACCCATCCAGACACTGACGATGATGCCGCCGAGATTGATGGTCTTGCC
ACGGCTCAGTCTATTCTCTCGGCTGCCGAGATTTCTCTGCCCACTGGCGACTTGGTCAATGGCGCCTACGACTCC
CTGGGCAACTTTTACCAGATGCATGCGTGGCTTGTTGCTGATCCGACAAACCTGGCTCATGACGATGAGGATCAC
GACGATGACTCAGGTGATGACGCTGAGAGCCATCGCAGCTTGTCTCCTACCCGCAAGCAATCAATCCTCAGAACA
GACCATGACGACGACGCCGAGCTCTCCTCGTCTGATAGCATCGACAAGAGGCGGCGAGAAAAGGGCAAGGCTGTT
CTCGATATGCGTGACCATTTATCGGTCCGTGCCCGTCTTAGCGACTCGGGCCGCGATGTCAACGTCTCGGTTCGC
AAATCAGATGCTGGCCGCACCGTCATCAGAGCCATTGTTTCTGAATCTGCGCTGCCTCCTAGCAAAAAGATACGC
CTGGCCTACATGGGCAAAATGCTTCGCGACGACTTGACACTCGAATCCCAAGGCTGGCAGACGGGTCACGTCATC
AATGCCCTCGTCTTCCCGAGATAG
Gene >OphauG2|4196
ATGGTACTCATTGTCCCATCACCAAATCTCTTGATGGCTGCCCTTTTGCTTTCTTTTTTCTCGGCTGACGCTTCC
CTCCTGGCCTCTGTAGGGCTGCTGCTTCTCCTCAACAGCGGGCTCAAGCTCGTCGTTTCCCGACAGTGGCCCTAA
TGCCTCGTCTCGTCGCATCAGCTCCGCCTCGCTGAATCGCTCAGAGCGCCCCGGCTCGCAGACTTGCTCGACGCG
CCGCCGCCGCAGAGACACGGGGGCCCTTGATCAGCACATTGACAAGCCTCTGCGTCGCCATGAGTGGACGAGCAA
GGACCGCCGCTGGACGCGCAGCCAACTGGATGCCGAGCGCGCTGCGTTTTTTGACACGCGCGTCACTGGCCGCCC
TGAGATATGGCAGACGATTCGCGCTGCTCTAAGCGTCTTGACCCATCCAGACACTGACGATGATGCCGCCGAGAT
TGATGGTCTTGCCACGGCTCAGTCTATTCTCTCGGCTGCCGAGATTTCTCTGCCCACTGGCGACTTGGTCAATGG
CGCCTACGACTCCCTGGGCAACTTTTACCAGATGCATGCGTGGCTTGTTGCTGATCCGACAAACCTGGCTCATGA
CGATGAGGATCACGACGATGACTCAGGTGATGACGCTGAGAGCCATCGCAGCTTGTCTCCTACCCGCAAGCAATC
AATCCTCAGAACAGACCATGACGACGACGCCGAGCTCTCCTCGTCTGATAGCATCGACAAGAGGCGGCGAGAAAA
GGGCAAGGCTGTTCTCGATATGCGTGACCATTTATCGGTCCGTGCCCGTCTTAGCGACTCGGGCCGCGATGTCAA
CGTCTCGGTTCGCAAATCAGATGCTGGCCGCACCGTCATCAGAGCCATTGTTTCTGAATCTGCGGTACCCCTCCC
CTTTTTATCCCCTGTACGCTGCGTGCCAAGGCTGACGCCATGTCTTGTCTATTACAGCTGCCTCCTAGCAAAAAG
ATACGCCTGGCCTACATGGGCAAAATGCTTCGCGACGACTTGACACTCGAATCCCAAGGCTGGCAGACGGGTCAC
GTCATCAATGCCCTCGTCTTCCCGAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail