Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4191
Gene name
LocationContig_340:6315..8915
Strand+
Gene length (bp)2600
Transcript length (bp)2466
Coding sequence length (bp)2466
Protein length (aa) 822

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12569 NatA_aux_su N-terminal acetyltransferase A, auxiliary subunit 3.2E-191 184 685
PF13432 TPR_16 Tetratricopeptide repeat 1.0E-03 226 287
PF13181 TPR_8 Tetratricopeptide repeat 7.6E-03 80 109
PF13181 TPR_8 Tetratricopeptide repeat 1.3E-02 227 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 1 770 4.0E-161
sp|Q9DBB4|NAA16_MOUSE N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Mus musculus GN=Naa16 PE=2 SV=1 1 770 2.0E-158
sp|Q80UM3|NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus GN=Naa15 PE=1 SV=1 5 771 8.0E-157
sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 5 771 9.0E-157
sp|O74985|NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat1 PE=1 SV=1 5 685 5.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 1 770 4.0E-161
sp|Q9DBB4|NAA16_MOUSE N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Mus musculus GN=Naa16 PE=2 SV=1 1 770 2.0E-158
sp|Q80UM3|NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus GN=Naa15 PE=1 SV=1 5 771 8.0E-157
sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 5 771 9.0E-157
sp|O74985|NAT1_SCHPO N-terminal acetyltransferase A complex subunit nat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat1 PE=1 SV=1 5 685 5.0E-156
sp|Q5R4J9|NAA15_PONAB N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Pongo abelii GN=NAA15 PE=2 SV=1 5 771 2.0E-155
sp|P12945|NAT1_YEAST N-terminal acetyltransferase A complex subunit NAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT1 PE=1 SV=2 2 641 7.0E-102
sp|Q9Y7X2|YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC418.02 PE=3 SV=1 5 657 1.0E-53
sp|O06917|Y263_METJA TPR repeat-containing protein MJ0263 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0263 PE=3 SV=1 2 251 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4191
MPQPLAPKEAAQFRAVIRSYEDKQYKRGIKTADTILKKHPKHGDTMAMKALILNGQGKTDEAFALAKEALTIDMK
SHVCWHVYGLLYRANKNFEEALKAYKFALKLEPESIQIQRDLAILQAQMRDYQGYIQSRTSMLQARPQLRACWTA
LAIAHHLAGSLSEAENVLTTYEGTLKSTPPRHDVEHSEAVMYKNSLIAEQKDYQRALDHLNSAAKHNLDRLAVME
ARAHYLTKLGRQEEAVKAYRALLDRNPEHPAYYEKVITVMAISETDLKARKAVYDEYAQKSPRCDAARRIPLDFL
QGDEFRQAAKDYLALMFDKGVPSTFANLKHLYSDSAKKETLRELVLEYLQSQSADTSSKDKGEAAALYYLAQHYN
YRLSRDLAKAMDYVNKAIEKDSASVDFHMTKARILKHGGDLVQAAAMMEHARTLDLKDRYINSKAAKYQLRINQN
DKALKTAGLFTRADTVGGPLADFLDMQCIWYLTEDGEAYARQGNIGLALKRFHAVSNIFDVWQEDQFDFHSFSLR
KGQIRAYIDMMRWEDHLRDHPFYARAAEQTIKIYIDMANKPATNGINGNEGESAEDALAKKKAAKKAKKEQQRLE
REAAEKAAKQDPNKAGAQGGETKKQDDDPLGLKLAATTDPLGEAMKFVEPLLQARPKSIEAQLIGFEVFMLRRKY
VQALRCLNTALKLDGDAAKVHEQVVAFGKMMETTTDLPPEVAEVLKAEFKALGESKNVAKYAEEVAAKHKNSPRH
ALSAIAVKRFLGESKGCGAVDKQVVGLLDMEGIVFDDAVVMLERLRQWRSSEVEAFKKAAQAKWPGVTRLA*
Coding >OphauG2|4191
ATGCCGCAACCCCTAGCGCCCAAAGAGGCGGCACAGTTTCGGGCCGTGATTCGCAGCTATGAGGACAAGCAGTAT
AAGCGCGGCATCAAGACGGCCGACACAATCCTCAAAAAGCATCCCAAGCATGGCGACACCATGGCAATGAAGGCC
CTCATACTCAACGGCCAAGGCAAGACGGACGAGGCGTTTGCGCTGGCCAAGGAGGCCCTGACAATCGACATGAAG
TCCCACGTCTGCTGGCACGTCTACGGCCTGCTCTACCGCGCCAATAAGAACTTTGAAGAGGCGCTCAAGGCATAC
AAGTTTGCTCTCAAGCTGGAGCCTGAGTCGATCCAGATTCAGCGCGACCTAGCCATTCTCCAAGCACAGATGCGA
GACTATCAAGGATACATCCAGAGTCGCACTTCGATGCTGCAAGCACGGCCTCAGTTGCGCGCGTGCTGGACAGCT
CTGGCCATTGCACACCACTTGGCTGGCAGCCTGTCCGAGGCGGAAAACGTACTGACCACTTATGAAGGCACTCTC
AAGTCGACTCCTCCCCGACATGACGTGGAACACTCCGAGGCCGTCATGTACAAGAACTCGTTGATAGCCGAGCAA
AAAGACTACCAACGGGCCCTAGACCATCTCAATAGCGCTGCAAAACACAATCTTGATCGCTTAGCTGTCATGGAA
GCCCGTGCTCACTACCTTACCAAACTTGGGCGTCAAGAAGAGGCAGTCAAGGCGTATAGAGCGCTGCTTGACCGC
AACCCGGAGCATCCTGCCTATTATGAAAAAGTCATTACCGTCATGGCCATTTCGGAAACCGACCTCAAGGCGCGC
AAAGCTGTATACGACGAATATGCTCAAAAGTCGCCTCGTTGCGACGCTGCCCGACGCATTCCTCTAGACTTTCTT
CAAGGCGACGAGTTTAGGCAAGCCGCCAAAGACTATCTAGCTCTCATGTTTGACAAGGGCGTCCCATCAACATTT
GCAAACCTCAAGCACCTCTACTCTGACTCGGCCAAGAAGGAGACACTAAGAGAGCTTGTTTTAGAGTATTTGCAG
TCCCAATCAGCGGATACGTCAAGCAAGGACAAGGGCGAGGCCGCTGCCCTTTACTACTTGGCACAGCACTACAAT
TACCGCCTGAGTCGTGACTTGGCCAAAGCCATGGATTATGTCAACAAGGCCATTGAGAAGGACTCTGCCAGCGTC
GACTTCCACATGACCAAAGCCAGAATACTCAAACACGGTGGCGACCTCGTCCAGGCCGCTGCCATGATGGAACAC
GCCCGAACACTGGATCTCAAGGATCGCTATATCAACAGCAAGGCAGCAAAGTACCAGCTGCGAATCAACCAAAAC
GACAAGGCGCTCAAGACTGCCGGGCTGTTTACGCGGGCCGACACAGTAGGCGGCCCGCTGGCTGACTTTTTGGAC
ATGCAGTGCATCTGGTACTTGACAGAGGATGGCGAGGCTTACGCCAGGCAAGGAAACATTGGCCTGGCATTGAAA
CGGTTCCACGCCGTAAGCAATATTTTTGATGTGTGGCAGGAGGACCAATTCGACTTTCACAGCTTCTCATTGAGA
AAGGGTCAGATTCGGGCTTATATCGACATGATGCGGTGGGAAGACCACCTCCGCGACCACCCCTTTTATGCAAGG
GCAGCTGAGCAAACCATCAAGATATACATCGACATGGCAAACAAGCCGGCGACCAATGGCATCAATGGTAACGAG
GGCGAAAGCGCCGAAGACGCCCTGGCCAAGAAGAAGGCAGCCAAAAAGGCGAAGAAGGAGCAGCAACGGTTAGAG
AGAGAGGCGGCTGAAAAGGCAGCCAAGCAAGATCCCAACAAGGCAGGTGCTCAAGGGGGAGAGACAAAGAAGCAG
GACGATGATCCTCTGGGCCTCAAGTTGGCAGCGACGACGGATCCGCTGGGCGAGGCCATGAAGTTTGTAGAGCCT
CTGCTTCAGGCACGACCCAAAAGTATTGAGGCACAATTGATTGGATTTGAGGTGTTTATGCTGCGAAGAAAATAT
GTACAGGCCTTGCGCTGTCTCAATACTGCACTAAAGCTAGATGGCGACGCGGCAAAGGTTCATGAGCAGGTTGTG
GCTTTTGGCAAAATGATGGAAACGACGACTGACTTGCCGCCCGAGGTGGCTGAAGTTCTCAAGGCAGAGTTTAAG
GCATTGGGGGAGTCAAAGAATGTGGCCAAGTATGCAGAAGAAGTTGCGGCCAAGCATAAAAACAGTCCTCGACAT
GCCCTTTCTGCGATTGCGGTAAAGCGGTTTCTAGGCGAGTCCAAGGGCTGCGGCGCAGTTGACAAGCAAGTTGTG
GGATTGCTCGACATGGAAGGCATTGTATTCGACGATGCAGTCGTCATGTTGGAGAGGCTGAGACAGTGGAGAAGC
TCAGAAGTGGAAGCGTTCAAAAAGGCGGCACAGGCCAAGTGGCCCGGAGTGACACGGCTGGCTTGA
Transcript >OphauG2|4191
ATGCCGCAACCCCTAGCGCCCAAAGAGGCGGCACAGTTTCGGGCCGTGATTCGCAGCTATGAGGACAAGCAGTAT
AAGCGCGGCATCAAGACGGCCGACACAATCCTCAAAAAGCATCCCAAGCATGGCGACACCATGGCAATGAAGGCC
CTCATACTCAACGGCCAAGGCAAGACGGACGAGGCGTTTGCGCTGGCCAAGGAGGCCCTGACAATCGACATGAAG
TCCCACGTCTGCTGGCACGTCTACGGCCTGCTCTACCGCGCCAATAAGAACTTTGAAGAGGCGCTCAAGGCATAC
AAGTTTGCTCTCAAGCTGGAGCCTGAGTCGATCCAGATTCAGCGCGACCTAGCCATTCTCCAAGCACAGATGCGA
GACTATCAAGGATACATCCAGAGTCGCACTTCGATGCTGCAAGCACGGCCTCAGTTGCGCGCGTGCTGGACAGCT
CTGGCCATTGCACACCACTTGGCTGGCAGCCTGTCCGAGGCGGAAAACGTACTGACCACTTATGAAGGCACTCTC
AAGTCGACTCCTCCCCGACATGACGTGGAACACTCCGAGGCCGTCATGTACAAGAACTCGTTGATAGCCGAGCAA
AAAGACTACCAACGGGCCCTAGACCATCTCAATAGCGCTGCAAAACACAATCTTGATCGCTTAGCTGTCATGGAA
GCCCGTGCTCACTACCTTACCAAACTTGGGCGTCAAGAAGAGGCAGTCAAGGCGTATAGAGCGCTGCTTGACCGC
AACCCGGAGCATCCTGCCTATTATGAAAAAGTCATTACCGTCATGGCCATTTCGGAAACCGACCTCAAGGCGCGC
AAAGCTGTATACGACGAATATGCTCAAAAGTCGCCTCGTTGCGACGCTGCCCGACGCATTCCTCTAGACTTTCTT
CAAGGCGACGAGTTTAGGCAAGCCGCCAAAGACTATCTAGCTCTCATGTTTGACAAGGGCGTCCCATCAACATTT
GCAAACCTCAAGCACCTCTACTCTGACTCGGCCAAGAAGGAGACACTAAGAGAGCTTGTTTTAGAGTATTTGCAG
TCCCAATCAGCGGATACGTCAAGCAAGGACAAGGGCGAGGCCGCTGCCCTTTACTACTTGGCACAGCACTACAAT
TACCGCCTGAGTCGTGACTTGGCCAAAGCCATGGATTATGTCAACAAGGCCATTGAGAAGGACTCTGCCAGCGTC
GACTTCCACATGACCAAAGCCAGAATACTCAAACACGGTGGCGACCTCGTCCAGGCCGCTGCCATGATGGAACAC
GCCCGAACACTGGATCTCAAGGATCGCTATATCAACAGCAAGGCAGCAAAGTACCAGCTGCGAATCAACCAAAAC
GACAAGGCGCTCAAGACTGCCGGGCTGTTTACGCGGGCCGACACAGTAGGCGGCCCGCTGGCTGACTTTTTGGAC
ATGCAGTGCATCTGGTACTTGACAGAGGATGGCGAGGCTTACGCCAGGCAAGGAAACATTGGCCTGGCATTGAAA
CGGTTCCACGCCGTAAGCAATATTTTTGATGTGTGGCAGGAGGACCAATTCGACTTTCACAGCTTCTCATTGAGA
AAGGGTCAGATTCGGGCTTATATCGACATGATGCGGTGGGAAGACCACCTCCGCGACCACCCCTTTTATGCAAGG
GCAGCTGAGCAAACCATCAAGATATACATCGACATGGCAAACAAGCCGGCGACCAATGGCATCAATGGTAACGAG
GGCGAAAGCGCCGAAGACGCCCTGGCCAAGAAGAAGGCAGCCAAAAAGGCGAAGAAGGAGCAGCAACGGTTAGAG
AGAGAGGCGGCTGAAAAGGCAGCCAAGCAAGATCCCAACAAGGCAGGTGCTCAAGGGGGAGAGACAAAGAAGCAG
GACGATGATCCTCTGGGCCTCAAGTTGGCAGCGACGACGGATCCGCTGGGCGAGGCCATGAAGTTTGTAGAGCCT
CTGCTTCAGGCACGACCCAAAAGTATTGAGGCACAATTGATTGGATTTGAGGTGTTTATGCTGCGAAGAAAATAT
GTACAGGCCTTGCGCTGTCTCAATACTGCACTAAAGCTAGATGGCGACGCGGCAAAGGTTCATGAGCAGGTTGTG
GCTTTTGGCAAAATGATGGAAACGACGACTGACTTGCCGCCCGAGGTGGCTGAAGTTCTCAAGGCAGAGTTTAAG
GCATTGGGGGAGTCAAAGAATGTGGCCAAGTATGCAGAAGAAGTTGCGGCCAAGCATAAAAACAGTCCTCGACAT
GCCCTTTCTGCGATTGCGGTAAAGCGGTTTCTAGGCGAGTCCAAGGGCTGCGGCGCAGTTGACAAGCAAGTTGTG
GGATTGCTCGACATGGAAGGCATTGTATTCGACGATGCAGTCGTCATGTTGGAGAGGCTGAGACAGTGGAGAAGC
TCAGAAGTGGAAGCGTTCAAAAAGGCGGCACAGGCCAAGTGGCCCGGAGTGACACGGCTGGCTTGA
Gene >OphauG2|4191
ATGCCGCAACCCCTAGCGCCCAAAGAGGCGGCACAGTTTCGGGCCGTGATTCGCAGCTATGAGGACAAGCAGTAT
AAGCGCGGCATCAAGACGGCCGACACAATCCTCAAAAAGCATCCCAAGCATGGCGACACCATGGCAATGAAGGCC
CTCATACTCAACGGCCAAGGCAAGACGGACGAGGCGTTTGCGCTGGCCAAGGAGGCCCTGACAATCGACATGAAG
TCCCACGTCTGCTGGCACGTCTACGGCCTGCTCTACCGCGCCAATAAGAACTTTGAAGAGGCGCTCAAGGCATAC
AAGTTTGCTCTCAAGCTGGAGCCTGAGTCGATCCAGATTCAGCGCGACCTAGCCATTCTCCAAGCACAGATGCGA
GACTATCAAGGATACATCCAGAGTCGCACTTCGATGCTGCAAGCACGGCCTCAGTTGCGCGCGTGCTGGACAGCT
CTGGCCATTGCACACCACTTGGCTGGCAGCCTGTCCGAGGCGGAAAACGTACTGACCACTTATGAAGGCACTCTC
AAGTCGACTCCTCCCCGACATGACGTGGAACACTCCGAGGCCGTCATGTACAAGAACTCGTTGATAGCCGAGCAA
AAAGACTACCAACGGGCCCTAGACCATCTCAATAGCGCTGCAAAACACAATCTTGATCGCTTAGCTGTCATGGAA
GCCCGTGCTCACTACCTTACCAAACTTGGGCGTCAAGAAGAGGCAGTCAAGGCGTATAGAGCGCTGCTTGACCGC
AACCCGGAGCATCCTGCCTATTATGAAAAAGTCATTACCGTCATGGCCATTTCGGAAACCGACCTCAAGGCGCGC
AAAGCTGTATACGACGAATATGCTCAAAAGTCGCCTCGTTGCGACGCTGCCCGACGCATTCCTCTAGACTTTCTT
CAAGGTGCGTAGCCTGGTTGTTCGAGTAATAAAAAACACGGTTCATAATCGCCGACTGACATTGGCTTCCAGGCG
ACGAGTTTAGGCAAGCCGCCAAAGACTATCTAGCTCTCATGTTTGACAAGGGCGTCCCATCAACATTTGCAAACC
TCAAGCACCTCTACTCTGACTCGGCCAAGAAGGAGACACTAAGAGAGCTTGTTTTAGAGTATTTGCAGTCCCAAT
CAGCGGATACGTCAAGCAAGGACAAGGGCGAGGCCGCTGCCCTTTACTACTTGGCACAGCACTACAATTACCGCC
TGAGTCGTGACTTGGCCAAAGCCATGGATTATGTCAACAAGGCCATTGAGAAGGACTCTGCCAGCGTCGACTTCC
ACATGACCAAAGCCAGAATACTCAAACACGGTGGCGACCTCGTCCAGGCCGCTGCCATGATGGAACACGCCCGAA
CACTGGATCTCAAGGATCGCTATATCAACAGCAAGGCAGCAAAGTACCAGCTGCGAATCAACCAAAACGACAAGG
CGCTCAAGACTGCCGGGCTGTTTACGCGGGCCGACACAGTAGGCGGCCCGCTGGCTGACTTTTTGGACATGCAGT
GCATCTGGTACTTGACAGAGGATGGCGAGGCTTACGCCAGGCAAGGAAACATTGGCCTGGCATTGAAACGGTTCC
ACGCCGTAAGCAATATTTTTGATGTGTGGCAGGAGGACCAATTCGACTTTCACAGCTTCTCATTGAGAAAGGGTC
AGATTCGGGCTTATATCGACATGATGCGGTGGGAAGACCACCTCCGCGACCACCCCTTTTATGCAAGGGCAGCTG
AGCAAACCATCAAGATATACATCGACATGGCAAACAAGCCGGCGACCAATGGCATCAATGGTAACGAGGGCGAAA
GCGCCGAAGACGCCCTGGCCAAGAAGAAGGCAGCCAAAAAGGCGAAGAAGGAGCAGCAACGGTTAGAGAGAGAGG
CGGCTGAAAAGGCAGCCAAGCAAGATCCCAACAAGGCAGGTGCTCAAGGGGGAGAGACAAAGAAGCAGGACGATG
ATCCTCTGGGCCTCAAGTTGGCAGCGACGACGGATCCGCTGGGCGAGGCCATGAAGTTTGTAGAGCCTCTGCTTC
AGGCACGACCCAAAAGTATTGAGGCACAATTGATTGGATTTGAGGTGTTTATGCTGCGAAGTAAGTCAAGAATAT
ACCCACATTCAAGCGAGCACGGGGAGGTCTAGGGCTAATCCAGTGGGTTAGGAAAATATGTACAGGCCTTGCGCT
GTCTCAATACTGCACTAAAGCTAGATGGCGACGCGGCAAAGGTTCATGAGCAGGTTGTGGCTTTTGGCAAAATGA
TGGAAACGACGACTGACTTGCCGCCCGAGGTGGCTGAAGTTCTCAAGGCAGAGTTTAAGGCATTGGGGGAGTCAA
AGAATGTGGCCAAGTATGCAGAAGAAGTTGCGGCCAAGCATAAAAACAGTCCTCGACATGCCCTTTCTGCGATTG
CGGTAAAGCGGTTTCTAGGCGAGTCCAAGGGCTGCGGCGCAGTTGACAAGCAAGTTGTGGGATTGCTCGACATGG
AAGGCATTGTATTCGACGATGCAGTCGTCATGTTGGAGAGGCTGAGACAGTGGAGAAGCTCAGAAGTGGAAGCGT
TCAAAAAGGCGGCACAGGCCAAGTGGCCCGGAGTGACACGGCTGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail