Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4189
Gene name
LocationContig_340:2715..4039
Strand-
Gene length (bp)1324
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 1.4E-55 21 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35844|KES1_YEAST Oxysterol-binding protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KES1 PE=1 SV=1 9 356 1.0E-112
sp|P35843|HES1_YEAST Protein HES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HES1 PE=1 SV=1 9 389 3.0E-105
sp|O74178|KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kes1 PE=2 SV=2 8 373 4.0E-102
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 14 360 5.0E-94
sp|O43021|YGV7_SCHPO Oxysterol-binding protein homolog C354.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.07c PE=3 SV=4 10 352 6.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35844|KES1_YEAST Oxysterol-binding protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KES1 PE=1 SV=1 9 356 1.0E-112
sp|P35843|HES1_YEAST Protein HES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HES1 PE=1 SV=1 9 389 3.0E-105
sp|O74178|KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kes1 PE=2 SV=2 8 373 4.0E-102
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 14 360 5.0E-94
sp|O43021|YGV7_SCHPO Oxysterol-binding protein homolog C354.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.07c PE=3 SV=4 10 352 6.0E-81
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 27 358 2.0E-35
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 27 379 3.0E-35
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 27 362 5.0E-35
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 27 352 2.0E-33
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 27 358 6.0E-33
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 25 362 6.0E-33
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 27 336 1.0E-32
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 18 358 2.0E-32
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 27 359 2.0E-32
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 27 358 2.0E-32
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 18 358 4.0E-32
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 27 352 2.0E-29
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 27 352 5.0E-29
sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens GN=OSBPL11 PE=1 SV=2 27 352 3.0E-28
sp|Q8CI95|OSB11_MOUSE Oxysterol-binding protein-related protein 11 OS=Mus musculus GN=Osbpl11 PE=1 SV=2 27 352 3.0E-28
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 27 352 2.0E-27
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 27 352 1.0E-26
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 27 340 1.0E-25
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 15 359 5.0E-24
sp|Q8MPQ7|OSB1_DICDI Oxysterol-binding protein 1 OS=Dictyostelium discoideum GN=osbA PE=1 SV=1 22 357 1.0E-16
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 16 356 2.0E-16
sp|Q54EF5|OSB12_DICDI Oxysterol-binding protein 12 OS=Dictyostelium discoideum GN=osbL PE=3 SV=1 15 352 1.0E-14
sp|Q55CR2|OSB3_DICDI Oxysterol-binding protein 3 OS=Dictyostelium discoideum GN=osbC PE=3 SV=1 27 337 3.0E-14
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 16 352 4.0E-13
sp|Q54RM1|OSB7_DICDI Oxysterol-binding protein 7 OS=Dictyostelium discoideum GN=osbG PE=3 SV=1 23 232 4.0E-12
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 14 258 2.0E-11
sp|Q86HV4|OSB6_DICDI Oxysterol-binding protein 6 OS=Dictyostelium discoideum GN=osbF PE=3 SV=1 17 352 8.0E-11
sp|O94512|OBP1_SCHPO Oxysterol-binding protein-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=obp1 PE=1 SV=1 120 367 1.0E-10
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 97 353 3.0E-10
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 12 356 3.0E-09
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 12 353 2.0E-08
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 14 259 2.0E-08
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 12 352 4.0E-08
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 14 259 5.0E-08
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 27 337 5.0E-08
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 27 337 2.0E-07
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 12 352 2.0E-06
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 12 273 2.0E-06
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 12 273 2.0E-06
sp|Q9LVD4|ORP4C_ARATH Oxysterol-binding protein-related protein 4C OS=Arabidopsis thaliana GN=ORP4C PE=2 SV=1 27 359 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008289 lipid binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4395
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4189 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8084
Ophiocordyceps camponoti-floridani Ophcf2|04708
Ophiocordyceps camponoti-rufipedis Ophun1|6407
Ophiocordyceps kimflemingae Ophio5|4430
Ophiocordyceps subramaniannii Hirsu2|9101

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4189
MTSAAAHSATSSSWSAFLKSIASFNGDLSSLTAPPFILSAKSLTEYSAYWATHPNLLAAPAAEPDAAKRAMLVVK
WFISTLKHQYASRCEQFGNEKKPLNPFLGELFLGSWTDETGETTLVSEQVSHHPPATAYCIRNNKTGVQLEGYNA
QKATFKSTIIVKQIGHAVLTVPLKAHGQDTVERYLITLPSLHIEGLIFGAPFVELDGASTIVSSSGYTAKVDYSG
RGWLSGKKNSVTATVHPTGKDKEILYNITGQWNKEFEIFHGPAKKNSEGTSLGIYDAVGTAQTELQVAPLDKQHP
LESRRAWAKVADAIQKGDLDVVATEKGKIEHAQRSLRALELSENRVWERRYFSAIDGEDKTLIEIGKAAGVPLDG
EQDKTGGLWRFDADKAAKAAAEQLTHDEVAKIQKELLGQE*
Coding >OphauG2|4189
ATGACGTCTGCAGCCGCCCACTCTGCCACCAGCAGCAGCTGGTCTGCCTTCCTCAAGTCAATTGCTTCCTTCAAT
GGCGACCTCTCTTCCCTAACAGCGCCCCCTTTTATCCTCTCCGCAAAGTCCTTGACCGAATACTCGGCGTATTGG
GCTACCCATCCCAATCTCCTCGCTGCTCCAGCTGCCGAGCCCGATGCCGCTAAGCGCGCTATGCTTGTCGTCAAG
TGGTTCATATCCACTCTAAAACACCAGTATGCCAGTCGCTGCGAACAGTTTGGTAACGAGAAGAAGCCTCTCAAC
CCCTTTCTCGGGGAGCTTTTCCTTGGCTCTTGGACCGACGAGACTGGAGAGACAACACTAGTGTCGGAACAGGTC
AGCCATCACCCTCCGGCCACTGCCTACTGCATTCGCAACAACAAGACAGGCGTTCAACTCGAGGGCTACAATGCG
CAAAAGGCCACTTTCAAGAGCACAATCATTGTCAAGCAGATTGGGCATGCCGTGCTTACAGTACCTCTGAAAGCC
CACGGTCAAGACACTGTCGAGCGCTATCTCATTACTCTTCCCTCGCTGCATATCGAAGGCCTCATCTTTGGGGCT
CCCTTTGTCGAACTCGACGGCGCCAGTACTATTGTCAGCTCAAGTGGCTACACCGCCAAGGTTGACTACAGCGGC
CGCGGTTGGCTGTCTGGCAAGAAGAACAGCGTGACCGCTACTGTGCACCCTACTGGAAAGGACAAGGAGATCTTG
TACAATATTACCGGCCAGTGGAACAAGGAGTTTGAGATATTCCATGGCCCTGCCAAGAAGAACTCGGAGGGGACC
TCTCTCGGCATCTATGACGCTGTTGGCACGGCCCAGACGGAGCTGCAAGTCGCGCCACTCGACAAGCAGCACCCC
CTCGAATCGCGACGCGCCTGGGCAAAAGTAGCTGATGCCATCCAAAAAGGCGACTTGGACGTTGTTGCCACGGAA
AAGGGCAAGATTGAGCATGCCCAGCGTAGTTTGCGCGCGCTTGAGCTTTCCGAGAACCGTGTCTGGGAGCGTCGA
TACTTTAGCGCTATTGACGGCGAGGATAAGACGCTCATTGAGATTGGCAAAGCTGCTGGCGTGCCCCTGGATGGC
GAGCAGGACAAGACGGGCGGACTCTGGCGCTTTGACGCCGACAAGGCTGCCAAGGCGGCTGCCGAGCAGCTGACG
CACGACGAGGTTGCCAAGATACAAAAGGAGTTATTGGGCCAAGAATAA
Transcript >OphauG2|4189
ATGACGTCTGCAGCCGCCCACTCTGCCACCAGCAGCAGCTGGTCTGCCTTCCTCAAGTCAATTGCTTCCTTCAAT
GGCGACCTCTCTTCCCTAACAGCGCCCCCTTTTATCCTCTCCGCAAAGTCCTTGACCGAATACTCGGCGTATTGG
GCTACCCATCCCAATCTCCTCGCTGCTCCAGCTGCCGAGCCCGATGCCGCTAAGCGCGCTATGCTTGTCGTCAAG
TGGTTCATATCCACTCTAAAACACCAGTATGCCAGTCGCTGCGAACAGTTTGGTAACGAGAAGAAGCCTCTCAAC
CCCTTTCTCGGGGAGCTTTTCCTTGGCTCTTGGACCGACGAGACTGGAGAGACAACACTAGTGTCGGAACAGGTC
AGCCATCACCCTCCGGCCACTGCCTACTGCATTCGCAACAACAAGACAGGCGTTCAACTCGAGGGCTACAATGCG
CAAAAGGCCACTTTCAAGAGCACAATCATTGTCAAGCAGATTGGGCATGCCGTGCTTACAGTACCTCTGAAAGCC
CACGGTCAAGACACTGTCGAGCGCTATCTCATTACTCTTCCCTCGCTGCATATCGAAGGCCTCATCTTTGGGGCT
CCCTTTGTCGAACTCGACGGCGCCAGTACTATTGTCAGCTCAAGTGGCTACACCGCCAAGGTTGACTACAGCGGC
CGCGGTTGGCTGTCTGGCAAGAAGAACAGCGTGACCGCTACTGTGCACCCTACTGGAAAGGACAAGGAGATCTTG
TACAATATTACCGGCCAGTGGAACAAGGAGTTTGAGATATTCCATGGCCCTGCCAAGAAGAACTCGGAGGGGACC
TCTCTCGGCATCTATGACGCTGTTGGCACGGCCCAGACGGAGCTGCAAGTCGCGCCACTCGACAAGCAGCACCCC
CTCGAATCGCGACGCGCCTGGGCAAAAGTAGCTGATGCCATCCAAAAAGGCGACTTGGACGTTGTTGCCACGGAA
AAGGGCAAGATTGAGCATGCCCAGCGTAGTTTGCGCGCGCTTGAGCTTTCCGAGAACCGTGTCTGGGAGCGTCGA
TACTTTAGCGCTATTGACGGCGAGGATAAGACGCTCATTGAGATTGGCAAAGCTGCTGGCGTGCCCCTGGATGGC
GAGCAGGACAAGACGGGCGGACTCTGGCGCTTTGACGCCGACAAGGCTGCCAAGGCGGCTGCCGAGCAGCTGACG
CACGACGAGGTTGCCAAGATACAAAAGGAGTTATTGGGCCAAGAATAA
Gene >OphauG2|4189
ATGACGTCTGCAGCCGCCCACTCTGCCACCAGCAGCAGCTGGTCTGCCTTCCTCAAGGTGCATATACACGATGCA
AATCCCAGTCACCCTCTTGGTCTCTGGCGACAGGGGCACTGACACTCGGCCTATGTAGTCAATTGCTTCCTTCAA
TGGCGACCTCTCTTCCCTAACAGCGCCCCCTTTTATCCTCTCCGCAAAGTCCTTGACCGAATACTCGGCGTATTG
GGCTACCCATCCCAATCTCCTCGCTGCTCCAGCTGCCGAGCCCGATGCCGCTAAGCGCGCTATGCTTGTCGTCAA
GTGGTTCATATCCACTCTAAAACACCAGTATGCCAGTCGCTGCGAACAGTTTGGTAACGAGAAGAAGCCTCTCAA
CCCCTTTCTCGGGGAGCTTTTCCTTGGCTCTTGGACCGACGAGACTGGAGAGACAACACTAGTGTCGGAACAGGT
CAGCCATCACCCTCCGGCCACTGCCTACTGCATTCGCAACAACAAGACAGGCGTTCAACTCGAGGGCTACAATGC
GCAAAAGGCCACTTTCAAGAGCACAATCATTGTCAAGCAGATTGGGCATGCCGTGCTTACAGTACCTCTGAAAGC
CCACGGTCAAGACACTGTCGAGCGCTATCTCATTACTCTTCCCTCGCTGCATATCGAAGGCCTCATCTTTGGGGC
TCCCTTTGTCGAACTCGACGGCGCCAGTACTATTGTCAGCTCAAGTGGCTACACCGCCAAGGTTGACTACAGCGG
CCGCGGTTGGCTGTCTGGCAAGAAGAACAGCGTGACCGCTACTGTGCACCCTACTGGAAAGGACAAGGAGATCTT
GTACAATATTACCGGCCAGTGGAACAAGGAGTTTGAGATATTCCATGGCCCTGCCAAGAAGAACTCGGAGGGGAC
CTCTCTCGGCATCTATGACGCTGTTGGCACGGCCCAGACGGAGCTGCAAGTCGCGCCACTCGACAAGCAGCACCC
CCTCGAATCGCGACGCGCCTGGGCAAAAGTAGCTGATGCCATCCAAAAAGGCGACTTGGACGTTGTTGCCACGGA
AAAGGGCAAGATTGAGCATGCCCAGCGTAGTTTGCGCGCGCTTGAGCTTTCCGAGAACCGTGTCTGGGAGCGTCG
ATACTTTAGCGCTATTGACGGCGAGGATAAGACGCTCATTGAGATTGGCAAAGCTGCTGGCGTGCCCCTGGATGG
CGAGCAGGACAAGACGGGCGGACTCTGGCGCTTTGACGCCGACAAGGCTGCCAAGGCGGCTGCCGAGCAGCTGAC
GCACGACGAGGTTGCCAAGATACAAAAGGAGTTATTGGGCCAAGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail