Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4188
Gene name
LocationContig_340:728..1997
Strand+
Gene length (bp)1269
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II 8.3E-93 19 359

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UH7|ALF1_PARBA Fructose-bisphosphate aldolase 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=FBA1 PE=1 SV=3 1 360 0.0E+00
sp|Q9HGY9|ALF_ASPOR Fructose-bisphosphate aldolase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fbaA PE=2 SV=2 1 360 0.0E+00
sp|P53444|ALF_NEUCR Fructose-bisphosphate aldolase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fba PE=3 SV=2 1 360 0.0E+00
sp|P14540|ALF_YEAST Fructose-bisphosphate aldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBA1 PE=1 SV=3 1 354 0.0E+00
sp|Q9C2U0|ALF_KLULA Fructose-bisphosphate aldolase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FBA1 PE=3 SV=2 1 360 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UH7|ALF1_PARBA Fructose-bisphosphate aldolase 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=FBA1 PE=1 SV=3 1 360 0.0E+00
sp|Q9HGY9|ALF_ASPOR Fructose-bisphosphate aldolase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fbaA PE=2 SV=2 1 360 0.0E+00
sp|P53444|ALF_NEUCR Fructose-bisphosphate aldolase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fba PE=3 SV=2 1 360 0.0E+00
sp|P14540|ALF_YEAST Fructose-bisphosphate aldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBA1 PE=1 SV=3 1 354 0.0E+00
sp|Q9C2U0|ALF_KLULA Fructose-bisphosphate aldolase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FBA1 PE=3 SV=2 1 360 0.0E+00
sp|Q9URB4|ALF_CANAL Fructose-bisphosphate aldolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FBA1 PE=1 SV=2 10 360 2.0E-175
sp|P36580|ALF_SCHPO Fructose-bisphosphate aldolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fba1 PE=1 SV=2 1 354 5.0E-171
sp|Q8J0N6|ALF2_PARBA Fructose-bisphosphate aldolase 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=FBA2 PE=2 SV=2 1 359 1.0E-156
sp|P44429|ALF_HAEIN Fructose-bisphosphate aldolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fba PE=3 SV=1 10 356 2.0E-134
sp|O52402|ALF_EDWI9 Fructose-bisphosphate aldolase OS=Edwardsiella ictaluri (strain 93-146) GN=fba PE=3 SV=2 10 356 7.0E-134
sp|Q0PAS0|ALF_CAMJE Fructose-bisphosphate aldolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fba PE=1 SV=1 1 356 9.0E-133
sp|A1VYV7|ALF_CAMJJ Fructose-bisphosphate aldolase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=fba PE=3 SV=1 1 356 1.0E-132
sp|P0AB73|ALF_SHIFL Fructose-bisphosphate aldolase class 2 OS=Shigella flexneri GN=fbaA PE=3 SV=2 10 355 2.0E-132
sp|P0AB71|ALF_ECOLI Fructose-bisphosphate aldolase class 2 OS=Escherichia coli (strain K12) GN=fbaA PE=1 SV=2 10 355 2.0E-132
sp|P0AB72|ALF_ECO57 Fructose-bisphosphate aldolase class 2 OS=Escherichia coli O157:H7 GN=fbaA PE=3 SV=2 10 355 2.0E-132
sp|Q8K9B2|ALF_BUCAP Fructose-bisphosphate aldolase class 2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fbaA PE=3 SV=1 12 355 8.0E-116
sp|O51401|ALF_BORBU Fructose-bisphosphate aldolase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=fba PE=1 SV=1 1 355 2.0E-114
sp|Q89AB6|ALF_BUCBP Fructose-bisphosphate aldolase class 2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fbaA PE=3 SV=1 8 360 1.0E-112
sp|P57526|ALF_BUCAI Fructose-bisphosphate aldolase class 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fbaA PE=3 SV=1 1 355 5.0E-112
sp|O69600|ALF_MYCLE Fructose-bisphosphate aldolase OS=Mycobacterium leprae (strain TN) GN=fba PE=3 SV=1 21 359 7.0E-77
sp|Q9X8R6|ALF_STRCO Fructose-bisphosphate aldolase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fba PE=3 SV=1 22 359 2.0E-71
sp|P9WQA3|ALF_MYCTU Fructose-bisphosphate aldolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fba PE=1 SV=1 21 359 4.0E-69
sp|P9WQA2|ALF_MYCTO Fructose-bisphosphate aldolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fba PE=3 SV=1 21 359 4.0E-69
sp|P67476|ALF_MYCBO Fructose-bisphosphate aldolase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fba PE=3 SV=1 21 359 4.0E-69
sp|Q9ZEM7|ALF_STRGB Fructose-bisphosphate aldolase OS=Streptomyces galbus GN=fba PE=1 SV=2 22 358 7.0E-68
sp|P19537|ALF_CORGL Fructose-bisphosphate aldolase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fba PE=1 SV=3 21 360 7.0E-67
sp|P75089|ALF_MYCPN Fructose-bisphosphate aldolase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=fba PE=3 SV=1 18 352 2.0E-28
sp|D4GYE0|ALF_HALVD Fructose-bisphosphate aldolase class 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=fba PE=1 SV=1 16 338 2.0E-26
sp|P47269|ALF_MYCGE Fructose-bisphosphate aldolase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=fba PE=3 SV=1 22 351 3.0E-25
sp|Q9PPP3|ALF_UREPA Fructose-bisphosphate aldolase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=fba PE=3 SV=1 21 360 6.0E-25
sp|P0A4S2|ALF_STRR6 Fructose-bisphosphate aldolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fba PE=1 SV=1 21 359 2.0E-22
sp|P0A4S1|ALF_STRPN Fructose-bisphosphate aldolase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fba PE=3 SV=1 21 359 2.0E-22
sp|P68906|ALF_STRP8 Fructose-bisphosphate aldolase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fba PE=3 SV=2 21 357 2.0E-21
sp|P68905|ALF_STRP1 Fructose-bisphosphate aldolase OS=Streptococcus pyogenes serotype M1 GN=fba PE=3 SV=2 21 357 2.0E-21
sp|Q5XA12|ALF_STRP6 Fructose-bisphosphate aldolase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fba PE=1 SV=3 21 357 4.0E-21
sp|P0CZ59|ALF_STRPQ Fructose-bisphosphate aldolase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fba PE=3 SV=1 21 357 7.0E-21
sp|P0CZ58|ALF_STRP3 Fructose-bisphosphate aldolase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fba PE=3 SV=1 21 357 7.0E-21
sp|Q8CNI3|ALF2_STAES Fructose-bisphosphate aldolase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fba PE=3 SV=1 26 359 2.0E-20
sp|Q5HM97|ALF2_STAEQ Fructose-bisphosphate aldolase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fba PE=3 SV=1 26 359 2.0E-20
sp|P67478|ALF2_STAAW Fructose-bisphosphate aldolase OS=Staphylococcus aureus (strain MW2) GN=fba PE=3 SV=1 26 359 8.0E-20
sp|Q6G7I5|ALF2_STAAS Fructose-bisphosphate aldolase OS=Staphylococcus aureus (strain MSSA476) GN=fba PE=3 SV=1 26 359 8.0E-20
sp|Q6GEV0|ALF2_STAAR Fructose-bisphosphate aldolase OS=Staphylococcus aureus (strain MRSA252) GN=fba PE=3 SV=1 26 359 8.0E-20
sp|P99075|ALF2_STAAN Fructose-bisphosphate aldolase OS=Staphylococcus aureus (strain N315) GN=fba PE=1 SV=1 26 359 8.0E-20
sp|P67477|ALF2_STAAM Fructose-bisphosphate aldolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fba PE=3 SV=1 26 359 8.0E-20
sp|Q5HE75|ALF2_STAAC Fructose-bisphosphate aldolase OS=Staphylococcus aureus (strain COL) GN=fba PE=3 SV=1 26 359 8.0E-20
sp|P94453|ALF_GEOSE Fructose-bisphosphate aldolase OS=Geobacillus stearothermophilus GN=fba PE=3 SV=3 22 359 2.0E-19
sp|P13243|ALF_BACSU Probable fructose-bisphosphate aldolase OS=Bacillus subtilis (strain 168) GN=fbaA PE=1 SV=2 21 359 7.0E-18
sp|P0CJ44|ALF_COCIM Putative fructose-bisphosphate aldolase OS=Coccidioides immitis (strain RS) GN=CIMG_05755 PE=1 SV=1 20 303 1.0E-16
sp|A9MPP7|KBAY_SALAR D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=kbaY PE=3 SV=1 22 360 3.0E-16
sp|A6TEF4|GATY_KLEP7 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gatY PE=3 SV=1 26 360 9.0E-16
sp|Q703I2|ALF_THECA Fructose-bisphosphate aldolase OS=Thermus caldophilus GN=fba PE=1 SV=1 13 359 1.0E-15
sp|Q59101|ALF2_CUPNH Fructose-bisphosphate aldolase, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbAP PE=3 SV=2 21 359 2.0E-15
sp|Q7CPQ7|GATY_SALTY D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gatY PE=3 SV=1 22 360 2.0E-15
sp|Q8XGZ9|GATY_SALTI D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella typhi GN=gatY PE=3 SV=1 22 360 2.0E-15
sp|Q59100|ALF1_CUPNH Fructose-bisphosphate aldolase, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbAC PE=3 SV=2 21 359 2.0E-15
sp|A9N6Z8|GATY_SALPB D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gatY PE=3 SV=1 22 360 2.0E-15
sp|Q65D09|IOLJ_BACLD 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=iolJ PE=3 SV=1 22 359 3.0E-15
sp|O87796|ALF_PSEST Fructose-bisphosphate aldolase OS=Pseudomonas stutzeri GN=fba PE=3 SV=1 21 358 4.0E-15
sp|Q9I5Y1|ALF_PSEAE Fructose-bisphosphate aldolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fba PE=3 SV=1 21 358 4.0E-15
sp|P29271|ALF2_RHOSH Fructose-bisphosphate aldolase 2 OS=Rhodobacter sphaeroides GN=cfxB PE=3 SV=1 21 359 1.0E-14
sp|B5BGG5|GATY_SALPK D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella paratyphi A (strain AKU_12601) GN=gatY PE=3 SV=1 22 360 2.0E-14
sp|Q5PL86|GATY_SALPA D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gatY PE=3 SV=1 22 360 2.0E-14
sp|Q56815|ALF_XANFL Fructose-bisphosphate aldolase OS=Xanthobacter flavus GN=cbbA PE=3 SV=1 21 359 2.0E-14
sp|Q83QY5|GATY_SHIFL D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Shigella flexneri GN=gatY PE=3 SV=4 21 359 2.0E-14
sp|O83668|ALF_TREPA Fructose-bisphosphate aldolase OS=Treponema pallidum (strain Nichols) GN=fba PE=3 SV=1 22 310 1.0E-13
sp|Q0T342|GATY_SHIF8 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Shigella flexneri serotype 5b (strain 8401) GN=gatY PE=3 SV=2 21 359 1.0E-13
sp|Q9XDP3|ALF_NOSCO Fructose-bisphosphate aldolase OS=Nostoc commune GN=fba PE=3 SV=1 22 358 2.0E-13
sp|C0PZ24|GATY_SALPC D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella paratyphi C (strain RKS4594) GN=gatY PE=3 SV=1 22 360 2.0E-13
sp|B4TIX9|GATY_SALHS D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella heidelberg (strain SL476) GN=gatY PE=3 SV=2 22 360 2.0E-13
sp|B5REK6|GATY_SALG2 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gatY PE=3 SV=1 22 360 2.0E-13
sp|B5QZS8|GATY_SALEP D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella enteritidis PT4 (strain P125109) GN=gatY PE=3 SV=1 22 360 2.0E-13
sp|B4T6B9|GATY_SALNS D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella newport (strain SL254) GN=gatY PE=3 SV=2 22 360 2.0E-13
sp|A7ZNR5|GATY_ECO24 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gatY PE=3 SV=1 21 359 3.0E-13
sp|B4TWB0|GATY_SALSV D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella schwarzengrund (strain CVM19633) GN=gatY PE=3 SV=1 22 360 4.0E-13
sp|P0C8J6|GATY_ECOLI D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain K12) GN=gatY PE=1 SV=1 21 359 4.0E-13
sp|B1IYY4|GATY_ECOLC D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gatY PE=3 SV=1 21 359 4.0E-13
sp|A8A1W1|GATY_ECOHS D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O9:H4 (strain HS) GN=gatY PE=3 SV=1 21 359 4.0E-13
sp|B1X7I7|GATY_ECODH D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain K12 / DH10B) GN=gatY PE=3 SV=1 21 359 4.0E-13
sp|C4ZSI0|GATY_ECOBW D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gatY PE=3 SV=1 21 359 4.0E-13
sp|Q8YNK2|ALF_NOSS1 Fructose-bisphosphate aldolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fda PE=1 SV=1 22 358 4.0E-13
sp|B7UFB3|GATY_ECO27 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gatY PE=3 SV=1 21 359 4.0E-13
sp|P0C8J7|GATY_ECOLX D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli GN=gatY PE=1 SV=1 21 359 4.0E-13
sp|B7NCC6|GATY_ECOLU D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gatY PE=3 SV=1 21 359 5.0E-13
sp|Q55664|ALF2_SYNY3 Fructose-bisphosphate aldolase class 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fbaA PE=1 SV=3 22 358 6.0E-13
sp|P42420|IOLJ_BACSU 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase OS=Bacillus subtilis (strain 168) GN=iolJ PE=1 SV=1 22 359 7.0E-13
sp|Q1R9X7|GATY_ECOUT D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain UTI89 / UPEC) GN=gatY PE=3 SV=2 21 359 1.0E-12
sp|A1ACW2|GATY_ECOK1 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O1:K1 / APEC GN=gatY PE=3 SV=1 21 359 1.0E-12
sp|B7MEF1|GATY_ECO45 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gatY PE=3 SV=1 21 359 1.0E-12
sp|Q8FFY7|GATY_ECOL6 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gatY PE=3 SV=2 21 359 1.0E-12
sp|B2TY92|GATY_SHIB3 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gatY PE=3 SV=1 21 359 1.0E-12
sp|B7M477|GATY_ECO8A D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O8 (strain IAI1) GN=gatY PE=3 SV=1 21 359 1.0E-12
sp|Q57JK9|GATY_SALCH D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Salmonella choleraesuis (strain SC-B67) GN=gatY PE=3 SV=1 22 360 1.0E-12
sp|B7L9W7|GATY_ECO55 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain 55989 / EAEC) GN=gatY PE=3 SV=1 21 359 1.0E-12
sp|B5YV43|GATY_ECO5E D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gatY PE=3 SV=1 21 359 2.0E-12
sp|Q8X4R2|GATY_ECO57 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O157:H7 GN=gatY PE=3 SV=3 21 359 2.0E-12
sp|B1LN92|GATY_ECOSM D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gatY PE=3 SV=1 21 359 2.0E-12
sp|Q3Z0B4|GATY_SHISS D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Shigella sonnei (strain Ss046) GN=gatY PE=3 SV=2 21 359 2.0E-12
sp|B7NPN7|GATY_ECO7I D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gatY PE=3 SV=1 21 359 2.0E-12
sp|P58336|ALF_RHIME Fructose-bisphosphate aldolase OS=Rhizobium meliloti (strain 1021) GN=cbbA PE=3 SV=1 21 358 3.0E-12
sp|Q8VS16|GATY_KLEOX D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Klebsiella oxytoca GN=gatY PE=1 SV=1 26 360 3.0E-12
sp|Q323C6|GATY_SHIBS D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Shigella boydii serotype 4 (strain Sb227) GN=gatY PE=3 SV=2 21 359 6.0E-12
sp|Q0TFZ6|GATY_ECOL5 D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gatY PE=3 SV=1 21 359 7.0E-12
sp|A7ZAH2|IOLJ_BACMF 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=iolJ PE=3 SV=1 22 359 7.0E-12
sp|P56109|ALF_HELPY Fructose-bisphosphate aldolase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fba PE=1 SV=1 13 360 8.0E-12
sp|A4WEV6|KBAY_ENT38 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Enterobacter sp. (strain 638) GN=kbaY PE=3 SV=1 22 343 8.0E-12
sp|Q32EA9|GATY_SHIDS D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gatY PE=3 SV=2 21 359 1.0E-11
sp|Q9KAH3|IOLJ_BACHD 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=iolJ PE=3 SV=1 22 359 2.0E-11
sp|Q9ZMQ6|ALF_HELPJ Fructose-bisphosphate aldolase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fba PE=3 SV=1 13 360 5.0E-11
sp|A8AQ28|KBAY_CITK8 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=kbaY PE=3 SV=1 22 343 6.0E-11
sp|P77704|YDJI_ECOLI Uncharacterized protein YdjI OS=Escherichia coli (strain K12) GN=ydjI PE=4 SV=1 31 303 1.0E-10
sp|P56888|ALF_SINMW Fructose-bisphosphate aldolase OS=Sinorhizobium medicae (strain WSM419) GN=cbbA PE=3 SV=2 21 358 2.0E-10
sp|B7LMU4|KBAY_ESCF3 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kbaY PE=3 SV=1 22 360 4.0E-10
sp|B7UJ37|KBAY_ECO27 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kbaY PE=3 SV=1 22 343 5.0E-10
sp|B7NKL0|KBAY_ECO7I D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kbaY PE=3 SV=1 22 343 5.0E-10
sp|B1LFP2|KBAY_ECOSM D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kbaY PE=3 SV=1 22 343 6.0E-10
sp|B7NDC5|KBAY_ECOLU D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kbaY PE=3 SV=1 22 343 6.0E-10
sp|Q5WKY5|IOLJ_BACSK 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase OS=Bacillus clausii (strain KSM-K16) GN=iolJ PE=3 SV=1 103 357 6.0E-10
sp|Q1R6K0|KBAY_ECOUT D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain UTI89 / UPEC) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|B6I1L2|KBAY_ECOSE D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain SE11) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|P0AB74|KBAY_ECOLI D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain K12) GN=kbaY PE=1 SV=1 22 343 7.0E-10
sp|B1IRH9|KBAY_ECOLC D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|P0AB75|KBAY_ECOL6 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|Q0TCW8|KBAY_ECOL5 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|A1AG46|KBAY_ECOK1 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O1:K1 / APEC GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|A8A4V3|KBAY_ECOHS D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O9:H4 (strain HS) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|B1XGU9|KBAY_ECODH D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain K12 / DH10B) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|C4ZR47|KBAY_ECOBW D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|B7M045|KBAY_ECO8A D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O8 (strain IAI1) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|B7N0S6|KBAY_ECO81 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O81 (strain ED1a) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|B5YS30|KBAY_ECO5E D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|P0AB76|KBAY_ECO57 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O157:H7 GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|B7LH72|KBAY_ECO55 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli (strain 55989 / EAEC) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|B7MB62|KBAY_ECO45 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|A7ZS33|KBAY_ECO24 D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kbaY PE=3 SV=1 22 343 7.0E-10
sp|P27995|ALF1_RHOSH Fructose-bisphosphate aldolase 1 OS=Rhodobacter sphaeroides GN=cfxA PE=3 SV=1 21 358 8.0E-10
sp|Q9KIP8|KBAY_ECOLX D-tagatose-1,6-bisphosphate aldolase subunit KbaY OS=Escherichia coli GN=kbaY PE=1 SV=1 22 343 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016832 aldehyde-lyase activity Yes
GO:0003674 molecular_function No
GO:0016830 carbon-carbon lyase activity No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0016829 lyase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4394
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4188 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8085
Ophiocordyceps camponoti-floridani Ophcf2|04719
Ophiocordyceps camponoti-rufipedis Ophun1|242
Ophiocordyceps kimflemingae Ophio5|4431
Ophiocordyceps subramaniannii Hirsu2|9100

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4188
MGVTEVLKRKTGVIVGDDVLRLFEYAREHKFAVPAINVTSSSTVIASLEAARDAKAPIILQVSQGGAAFFAGKGV
SNTNQEASVAGSVAAAHYIRSIAPAYGIPVILHTDHCAKKLLPWLDGMLDADEAYFKANGEPLFSSHMIDLSEEQ
VQWNIDTTAKYLKRAAPMKQWLEMEIGITGGEEDGVNNEDVDNNSLYTQPEDIYDIYKTLVKISPYFSIAAGFGN
VHGVYKPGNVRLHPELLGKHQKHVQATIKSDNDKPVFFVFHGGSGSSKQEYLDAIGHGVVKVNMDTDMQYAYMAG
IRDYMLNKKDYLMKPVGNPDGEDKPNKKYFDPRVWVREGEKTMSTRVTEALKDFNCAGQV*
Coding >OphauG2|4188
ATGGGTGTTACCGAGGTTCTGAAGCGCAAGACCGGCGTCATTGTCGGCGACGACGTTCTTCGTCTCTTCGAATAT
GCCCGCGAGCACAAATTTGCCGTCCCCGCTATTAACGTCACTTCCTCCTCCACCGTCATCGCTTCTCTCGAGGCT
GCCCGCGATGCCAAGGCTCCCATTATCCTCCAGGTGTCCCAGGGTGGAGCTGCCTTTTTTGCTGGCAAGGGTGTA
AGCAATACCAACCAGGAGGCCTCGGTTGCCGGCTCCGTTGCAGCCGCTCACTATATCCGCTCCATCGCTCCCGCG
TACGGAATTCCTGTCATCCTGCACACGGATCACTGCGCCAAGAAGCTCCTTCCCTGGCTTGATGGCATGCTCGAC
GCCGACGAGGCCTACTTCAAGGCCAACGGCGAGCCTCTCTTCAGCTCTCACATGATTGATCTGTCTGAGGAACAG
GTACAATGGAATATAGATACCACTGCCAAGTACCTCAAGCGCGCCGCGCCCATGAAGCAGTGGCTCGAGATGGAG
ATTGGCATCACTGGCGGCGAGGAGGATGGTGTCAACAATGAAGACGTTGACAACAATTCTCTTTACACCCAGCCC
GAAGACATTTACGACATCTACAAGACACTCGTTAAAATCTCTCCCTACTTCTCCATTGCCGCCGGCTTTGGCAAT
GTCCATGGCGTCTACAAGCCCGGCAATGTGCGCCTGCACCCAGAGCTGCTCGGCAAGCACCAGAAGCACGTCCAG
GCTACCATTAAATCCGACAATGACAAGCCCGTCTTCTTTGTCTTCCACGGCGGCTCCGGCTCCTCCAAGCAGGAG
TATCTTGATGCCATTGGTCATGGTGTCGTCAAGGTCAACATGGACACGGACATGCAGTACGCCTACATGGCGGGA
ATACGGGACTACATGCTCAACAAGAAGGACTACCTCATGAAGCCCGTTGGTAACCCAGACGGCGAGGACAAGCCC
AACAAGAAGTACTTTGACCCTCGTGTCTGGGTCCGCGAAGGCGAAAAGACCATGTCGACTCGCGTCACAGAGGCC
CTCAAGGACTTCAACTGCGCCGGCCAGGTGTAG
Transcript >OphauG2|4188
ATGGGTGTTACCGAGGTTCTGAAGCGCAAGACCGGCGTCATTGTCGGCGACGACGTTCTTCGTCTCTTCGAATAT
GCCCGCGAGCACAAATTTGCCGTCCCCGCTATTAACGTCACTTCCTCCTCCACCGTCATCGCTTCTCTCGAGGCT
GCCCGCGATGCCAAGGCTCCCATTATCCTCCAGGTGTCCCAGGGTGGAGCTGCCTTTTTTGCTGGCAAGGGTGTA
AGCAATACCAACCAGGAGGCCTCGGTTGCCGGCTCCGTTGCAGCCGCTCACTATATCCGCTCCATCGCTCCCGCG
TACGGAATTCCTGTCATCCTGCACACGGATCACTGCGCCAAGAAGCTCCTTCCCTGGCTTGATGGCATGCTCGAC
GCCGACGAGGCCTACTTCAAGGCCAACGGCGAGCCTCTCTTCAGCTCTCACATGATTGATCTGTCTGAGGAACAG
GTACAATGGAATATAGATACCACTGCCAAGTACCTCAAGCGCGCCGCGCCCATGAAGCAGTGGCTCGAGATGGAG
ATTGGCATCACTGGCGGCGAGGAGGATGGTGTCAACAATGAAGACGTTGACAACAATTCTCTTTACACCCAGCCC
GAAGACATTTACGACATCTACAAGACACTCGTTAAAATCTCTCCCTACTTCTCCATTGCCGCCGGCTTTGGCAAT
GTCCATGGCGTCTACAAGCCCGGCAATGTGCGCCTGCACCCAGAGCTGCTCGGCAAGCACCAGAAGCACGTCCAG
GCTACCATTAAATCCGACAATGACAAGCCCGTCTTCTTTGTCTTCCACGGCGGCTCCGGCTCCTCCAAGCAGGAG
TATCTTGATGCCATTGGTCATGGTGTCGTCAAGGTCAACATGGACACGGACATGCAGTACGCCTACATGGCGGGA
ATACGGGACTACATGCTCAACAAGAAGGACTACCTCATGAAGCCCGTTGGTAACCCAGACGGCGAGGACAAGCCC
AACAAGAAGTACTTTGACCCTCGTGTCTGGGTCCGCGAAGGCGAAAAGACCATGTCGACTCGCGTCACAGAGGCC
CTCAAGGACTTCAACTGCGCCGGCCAGGTGTAG
Gene >OphauG2|4188
ATGGGTGTTACCGAGGTTCTGAAGCGCAAGACCGGCGTCATTGTCGGCGACGACGTTCTTCGTCTCTTCGAATAT
GCCCGCGAGCACAAATTTGCCGTCCCCGCTATTGCAAGCTCTATCCTATCTCCATCTTGGCAACTCGTGCCCTTT
GATTGCTAACCTCTACGTTTCAGAACGTCACTTCCTCCTCCACCGTCATCGCTTCTCTCGAGGCTGCCCGCGATG
CCAAGGCTCCCATTATCCTCCAGGTGTCCCAGGGTGGAGCTGCCTTTTTTGCTGGCAAGGTAAACTTTTCATATC
CTCAATCCTGAAGCCTCAAAATCCTGACATGGTGCGTCGAAAGGGTGTAAGCAATACCAACCAGGAGGCCTCGGT
TGCCGGCTCCGTTGCAGCCGCTCACTATATCCGCTCCATCGCTCCCGCGTACGGAATTCCTGTCATCCTGCACAC
GGATCACTGCGCCAAGAAGCTCCTTCCCTGGCTTGATGGCATGCTCGACGCCGACGAGGCCTACTTCAAGGCCAA
CGGCGAGCCTCTCTTCAGCTCTCACATGATTGATCTGTCTGAGGAACAGGTACAATGGAATATAGATACCACTGC
CAAGTACCTCAAGCGCGCCGCGCCCATGAAGCAGTGGCTCGAGATGGAGATTGGCATCACTGGCGGCGAGGAGGA
TGGTGTCAACAATGAAGACGTTGACAACAATTCTCTTTACACCCAGCCCGAAGACATTTACGACATCTACAAGAC
ACTCGTTAAAATCTCTCCCTACTTCTCCATTGCCGCCGGCTTTGGCAATGTCCATGGCGTCTACAAGCCCGGCAA
TGTGCGCCTGCACCCAGAGCTGCTCGGCAAGCACCAGAAGCACGTCCAGGCTACCATTAAATCCGACAATGACAA
GCCCGTCTTCTTTGTCTTCCACGGCGGCTCCGGCTCCTCCAAGCAGGAGTATCTTGATGCCATTGGTCATGGTGT
CGTCAAGGTCAACATGGACACGGACATGCAGTACGCCTACATGGCGGGAATACGGGACTACATGCTCAACAAGAA
GGACTACCTCATGAAGCCCGTTGGTAACCCAGACGGCGAGGACAAGCCCAACAAGAAGTACTTTGACGTAGGTGT
CTCTGTTGCAACAAATGGCTAGTCGATTGGCTGAAACAACTAACTCTTTTGCAGCCTCGTGTCTGGGTCCGCGAA
GGCGAAAAGACCATGTCGACTCGCGTCACAGAGGCCCTCAAGGACTTCAACTGCGCCGGCCAGGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail