Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4186
Gene name
LocationContig_34:42175..43402
Strand-
Gene length (bp)1227
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.1E-11 92 372
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 8.6E-11 93 363
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.3E-07 90 202

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup413
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|129
Ophiocordyceps australis 1348a (Ghana) OphauG2|4186 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6252
Ophiocordyceps australis map64 (Brazil) OphauB2|6352
Ophiocordyceps camponoti-floridani Ophcf2|00448
Ophiocordyceps camponoti-rufipedis Ophun1|1825
Ophiocordyceps kimflemingae Ophio5|6661
Ophiocordyceps subramaniannii Hirsu2|2771
Ophiocordyceps subramaniannii Hirsu2|7207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4186
MLEFQSLSKTFGPTHVAFFLTTATCLSLYINTRLTLQNVSQAEKCISANTRHVAATGDSPYPLDVMPGGRTVESE
YGTIQVFEWGPQDGQKVLLIHGVSTPCLALRDMAREFEALGCRVMLFDLFGRGFSDAPRDIPYDDRLYTTQILLA
LASSPLAWTGDDAFHLVGYSLGGAIAAGFVAYRPNIARSLTLVCPGGLIRPHHVSLKSRFLYSRGILPSCLMNAI
VRYRLKPHQGKTSADIPVADDLDLDVPFDNVKLLPNVKVGDVVTWQLRHNQGFPQAYRSTMGNSPIYGQHSKGWT
RLAQHLKDRQGGARMPGLTNGRVCLILAKNDPIVIAQEWIEDCKALFGERGVRYHVLDGGHDIGISRGKLVANTA
IKTWSEPFQLDNGLD*
Coding >OphauG2|4186
ATGTTGGAATTCCAGTCCCTCTCCAAGACCTTTGGACCAACACACGTGGCTTTCTTCCTCACCACGGCAACTTGT
CTAAGCCTCTACATCAATACTAGGCTGACCCTCCAAAATGTGTCCCAGGCTGAGAAATGCATCTCGGCCAATACT
CGTCATGTAGCAGCCACCGGGGACTCACCCTATCCCCTTGATGTCATGCCCGGGGGACGTACTGTTGAGTCCGAG
TACGGCACAATACAAGTCTTTGAATGGGGCCCCCAAGACGGCCAAAAAGTGCTCCTGATTCACGGCGTAAGCACA
CCGTGCCTGGCACTGAGGGACATGGCCCGAGAATTCGAGGCGCTGGGTTGCAGGGTCATGCTCTTTGATCTCTTT
GGTAGAGGATTCTCTGATGCTCCCCGTGATATCCCTTATGACGATCGTCTCTACACCACGCAGATCCTCCTCGCC
CTCGCCTCGTCCCCTTTGGCTTGGACTGGCGATGACGCCTTTCATCTCGTCGGCTACTCGCTGGGTGGCGCCATT
GCAGCCGGCTTTGTCGCCTACCGCCCCAATATTGCTCGTTCCTTGACACTTGTCTGTCCTGGCGGGCTTATCCGA
CCCCATCACGTCTCCCTCAAGTCCCGCTTTCTTTACTCCCGAGGCATCTTGCCAAGTTGTTTAATGAACGCCATT
GTCCGCTACAGGCTCAAACCTCACCAAGGCAAAACCAGCGCCGACATTCCCGTTGCTGATGACCTTGACCTTGAC
GTTCCCTTTGACAATGTCAAACTCTTGCCGAATGTCAAAGTCGGAGATGTCGTGACATGGCAGCTCCGCCACAAC
CAAGGGTTTCCTCAGGCTTATAGGAGCACCATGGGCAACTCACCAATCTATGGGCAACATAGCAAGGGCTGGACG
CGCTTGGCTCAGCATCTGAAGGACCGTCAGGGCGGGGCACGCATGCCCGGCCTTACCAACGGGCGTGTGTGCCTT
ATACTCGCTAAAAATGATCCCATCGTCATTGCGCAAGAATGGATCGAAGATTGTAAAGCCTTGTTTGGAGAGCGA
GGCGTTAGATATCATGTGCTCGACGGTGGCCATGACATTGGCATTTCTCGGGGCAAGTTGGTGGCCAATACAGCA
ATCAAGACTTGGAGCGAACCCTTTCAACTAGACAACGGCTTGGATTAG
Transcript >OphauG2|4186
ATGTTGGAATTCCAGTCCCTCTCCAAGACCTTTGGACCAACACACGTGGCTTTCTTCCTCACCACGGCAACTTGT
CTAAGCCTCTACATCAATACTAGGCTGACCCTCCAAAATGTGTCCCAGGCTGAGAAATGCATCTCGGCCAATACT
CGTCATGTAGCAGCCACCGGGGACTCACCCTATCCCCTTGATGTCATGCCCGGGGGACGTACTGTTGAGTCCGAG
TACGGCACAATACAAGTCTTTGAATGGGGCCCCCAAGACGGCCAAAAAGTGCTCCTGATTCACGGCGTAAGCACA
CCGTGCCTGGCACTGAGGGACATGGCCCGAGAATTCGAGGCGCTGGGTTGCAGGGTCATGCTCTTTGATCTCTTT
GGTAGAGGATTCTCTGATGCTCCCCGTGATATCCCTTATGACGATCGTCTCTACACCACGCAGATCCTCCTCGCC
CTCGCCTCGTCCCCTTTGGCTTGGACTGGCGATGACGCCTTTCATCTCGTCGGCTACTCGCTGGGTGGCGCCATT
GCAGCCGGCTTTGTCGCCTACCGCCCCAATATTGCTCGTTCCTTGACACTTGTCTGTCCTGGCGGGCTTATCCGA
CCCCATCACGTCTCCCTCAAGTCCCGCTTTCTTTACTCCCGAGGCATCTTGCCAAGTTGTTTAATGAACGCCATT
GTCCGCTACAGGCTCAAACCTCACCAAGGCAAAACCAGCGCCGACATTCCCGTTGCTGATGACCTTGACCTTGAC
GTTCCCTTTGACAATGTCAAACTCTTGCCGAATGTCAAAGTCGGAGATGTCGTGACATGGCAGCTCCGCCACAAC
CAAGGGTTTCCTCAGGCTTATAGGAGCACCATGGGCAACTCACCAATCTATGGGCAACATAGCAAGGGCTGGACG
CGCTTGGCTCAGCATCTGAAGGACCGTCAGGGCGGGGCACGCATGCCCGGCCTTACCAACGGGCGTGTGTGCCTT
ATACTCGCTAAAAATGATCCCATCGTCATTGCGCAAGAATGGATCGAAGATTGTAAAGCCTTGTTTGGAGAGCGA
GGCGTTAGATATCATGTGCTCGACGGTGGCCATGACATTGGCATTTCTCGGGGCAAGTTGGTGGCCAATACAGCA
ATCAAGACTTGGAGCGAACCCTTTCAACTAGACAACGGCTTGGATTAG
Gene >OphauG2|4186
ATGTTGGAATTCCAGTCCCTCTCCAAGACCTTTGGACCAACACACGTGGCTTTCTTCCTCACCACGGCAACTTGT
CTAAGCCTCTACATCAATACTAGGCTGACCCTCCAAAATGTGTCCCAGGCTGAGAAATGCATCTCGGCCAATACT
CGTCATGTAGCAGCCACCGGGGACTCACCCTATCCCCTTGATGTCATGCCCGGGGGACGTACTGTTGAGTCCGAG
TACGGCACAATACAAGTCTTTGAATGGGGCCCCCAAGACGGCCAAAAAGTGCTCCTGATTCACGGCGTAAGCACA
CCGTGCCTGGCACTGAGGGACATGGCCCGAGAATTCGAGGCGCTGGGTTGCAGGGTCATGCTCTTTGGTCTGTCT
TGGCTCGGCTTGGCTTCACAGACCTGGCTGCTGACCACGTTTGCAGATCTCTTTGGTAGAGGATTCTCTGATGCT
CCCCGTGATATCCCTTATGACGATCGTCTCTACACCACGCAGATCCTCCTCGCCCTCGCCTCGTCCCCTTTGGCT
TGGACTGGCGATGACGCCTTTCATCTCGTCGGCTACTCGCTGGGTGGCGCCATTGCAGCCGGCTTTGTCGCCTAC
CGCCCCAATATTGCTCGTTCCTTGACACTTGTCTGTCCTGGCGGGCTTATCCGACCCCATCACGTCTCCCTCAAG
TCCCGCTTTCTTTACTCCCGAGGCATCTTGCCAAGTTGTTTAATGAACGCCATTGTCCGCTACAGGCTCAAACCT
CACCAAGGCAAAACCAGCGCCGACATTCCCGTTGCTGATGACCTTGACCTTGACGTTCCCTTTGACAATGTCAAA
CTCTTGCCGAATGTCAAAGTCGGAGATGTCGTGACATGGCAGCTCCGCCACAACCAAGGGTTTCCTCAGGCTTAT
AGGAGCACCATGGGCAACTCACCAATCTATGGGCAACATAGCAAGGGCTGGACGCGCTTGGCTCAGCATCTGAAG
GACCGTCAGGGCGGGGCACGCATGCCCGGCCTTACCAACGGGCGTGTGTGCCTTATACTCGCTAAAAATGATCCC
ATCGTCATTGCGCAAGAATGGATCGAAGATTGTAAAGCCTTGTTTGGAGAGCGAGGCGTTAGATATCATGTGCTC
GACGGTGGCCATGACATTGGCATTTCTCGGGGCAAGTTGGTGGCCAATACAGCAATCAAGACTTGGAGCGAACCC
TTTCAACTAGACAACGGCTTGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail