Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4141
Gene name
LocationContig_335:9842..11826
Strand-
Gene length (bp)1984
Transcript length (bp)1914
Coding sequence length (bp)1914
Protein length (aa) 638

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03909 BSD BSD domain 3.5E-13 144 206
PF03909 BSD BSD domain 2.8E-14 223 278
PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain 1.1E-24 10 96

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P5N7|TFB1_NEUCR Putative RNA polymerase II transcription factor B subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8B20.390 PE=3 SV=1 1 619 0.0E+00
sp|O13745|TFB1_SCHPO RNA polymerase II transcription factor B subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb1 PE=1 SV=2 9 566 1.0E-59
sp|Q960E8|TF2H1_DROME General transcription factor IIH subunit 1 OS=Drosophila melanogaster GN=Tfb1 PE=2 SV=1 3 268 5.0E-11
sp|P32780|TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens GN=GTF2H1 PE=1 SV=1 11 438 3.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4141
MAIPAGRTLFKKKDGILTLTPDRRTLTWTPNTGGPPTVSLPVASITNLQQTPDTSPKVMLKVFQKSETGGDAVPY
LFHFNTSEARAEAKVLKDILSTFLTDLRSNEVPRPAGADTPSAASGSASASMAFASAVNSHPSSTRWFDDDQLKA
DIELQQSLMKKDKSLHQLYVNAVDAKPESVSTAAFNSQFWSSRTDRLRLHAIDLNQKRGAYNVLSTVKPRTVDGE
LKLNISVEQVQMILEQHPLIKRIYNENVPKISEAQFWSRFFLSRLSKQLRGERVSESERPDPLFDKHDVSENTQS
FQNMIIARSVPRIIDVEANEENQGGFRSGNAKDVEMRPRANISIGKTFNSLSQSIMANAAPSDGNQGDPQGSFDT
LNQLMLHDLQGDRQQERIMLNVREQNRSFFSRDSTAPTANERIFAKQDPRQVLEAFKASLDQLDTYGPDRTALQA
LIDFDDESNSDEEEQRKSPFGSRAAYNAAEKEIMDRIRQQRSKEYGHDGDVTSPMGLSPVMTEKCTLAHATTIEF
LRQFWNAFLSGDANRALELQYLAQSLSQSATRLAAVADEAEVEREAAIRQRKHDIRIHFERTGKRLKWKSDMVGG
GRDAVNNLYRPTFITLEKAQHEYAKALEAEGIQASTE*
Coding >OphauG2|4141
ATGGCCATTCCCGCCGGGCGCACTCTTTTCAAAAAGAAAGATGGCATCCTCACCTTAACGCCCGACCGCCGAACC
CTGACATGGACTCCAAACACGGGCGGTCCTCCCACGGTGTCCCTGCCCGTTGCGAGCATCACCAACCTTCAGCAG
ACGCCAGACACGTCGCCCAAGGTGATGCTCAAGGTTTTTCAAAAGTCAGAAACCGGCGGTGATGCCGTCCCGTAT
TTATTCCACTTCAACACCAGCGAAGCTCGAGCAGAAGCCAAGGTCCTCAAGGACATTCTCTCTACTTTTTTGACC
GATCTGCGAAGCAATGAAGTCCCACGGCCCGCTGGAGCCGACACTCCTTCTGCCGCCTCGGGCAGTGCCTCGGCC
TCGATGGCTTTTGCCAGTGCTGTCAATTCGCATCCGTCATCGACGCGTTGGTTCGACGATGACCAACTCAAGGCC
GATATTGAGCTGCAGCAATCCCTCATGAAAAAAGACAAGTCGCTTCACCAGTTATATGTCAACGCCGTCGATGCA
AAGCCTGAGTCCGTATCCACCGCTGCCTTTAATTCTCAATTTTGGTCTTCACGCACGGATCGTTTGCGACTTCAC
GCTATTGACCTGAACCAAAAAAGAGGTGCCTATAATGTGCTGTCAACGGTCAAGCCTCGAACCGTTGACGGTGAG
CTCAAGCTTAACATTAGCGTCGAACAAGTGCAAATGATTTTGGAACAGCATCCTCTTATTAAACGCATCTATAAT
GAAAACGTCCCCAAGATTTCAGAGGCTCAGTTTTGGTCTCGATTCTTTCTCAGTAGGCTCTCCAAACAGCTTCGA
GGCGAGCGCGTCTCTGAATCGGAGCGTCCTGATCCCTTATTCGACAAGCACGACGTGAGCGAAAACACACAGAGT
TTTCAGAATATGATAATAGCCCGGAGTGTCCCACGCATCATCGACGTCGAAGCAAACGAAGAGAACCAAGGAGGC
TTTAGGAGCGGAAATGCCAAAGATGTGGAAATGAGGCCACGGGCCAACATATCCATTGGAAAAACGTTTAACAGC
CTCAGTCAGAGCATAATGGCAAATGCGGCCCCCTCAGATGGCAACCAGGGCGACCCGCAGGGCAGCTTTGACACG
TTGAATCAACTGATGCTACACGATCTCCAAGGCGATCGTCAGCAGGAGCGCATCATGCTCAACGTTCGAGAACAA
AATAGGTCTTTCTTCAGCCGTGATTCTACTGCGCCCACTGCCAATGAGCGCATATTTGCCAAGCAGGACCCTAGA
CAAGTCCTTGAAGCTTTCAAAGCTTCCCTTGACCAATTGGATACATATGGCCCCGACAGGACGGCGCTCCAGGCT
CTCATTGACTTTGACGACGAGAGCAACAGCGACGAAGAAGAGCAGAGAAAGTCGCCCTTTGGCTCCCGTGCAGCA
TACAACGCTGCGGAAAAGGAGATCATGGACCGCATCCGTCAGCAACGGTCAAAAGAATACGGCCACGATGGCGAC
GTCACATCACCCATGGGCCTGTCGCCAGTCATGACAGAAAAATGCACCTTGGCACATGCAACGACTATAGAGTTT
TTGCGCCAGTTTTGGAATGCCTTTCTCTCTGGCGATGCCAACCGTGCCCTCGAATTACAGTATCTGGCACAGTCG
CTCAGTCAATCGGCCACTCGCCTGGCCGCCGTGGCGGACGAAGCCGAGGTGGAGCGTGAAGCAGCGATTCGCCAG
CGCAAGCATGACATTCGCATTCACTTTGAACGTACCGGGAAAAGACTCAAGTGGAAGTCGGACATGGTTGGGGGC
GGACGCGATGCTGTCAACAACCTCTATCGGCCCACCTTTATTACTCTGGAAAAGGCGCAGCACGAGTACGCCAAG
GCCCTCGAGGCTGAAGGGATTCAGGCTTCTACCGAGTAA
Transcript >OphauG2|4141
ATGGCCATTCCCGCCGGGCGCACTCTTTTCAAAAAGAAAGATGGCATCCTCACCTTAACGCCCGACCGCCGAACC
CTGACATGGACTCCAAACACGGGCGGTCCTCCCACGGTGTCCCTGCCCGTTGCGAGCATCACCAACCTTCAGCAG
ACGCCAGACACGTCGCCCAAGGTGATGCTCAAGGTTTTTCAAAAGTCAGAAACCGGCGGTGATGCCGTCCCGTAT
TTATTCCACTTCAACACCAGCGAAGCTCGAGCAGAAGCCAAGGTCCTCAAGGACATTCTCTCTACTTTTTTGACC
GATCTGCGAAGCAATGAAGTCCCACGGCCCGCTGGAGCCGACACTCCTTCTGCCGCCTCGGGCAGTGCCTCGGCC
TCGATGGCTTTTGCCAGTGCTGTCAATTCGCATCCGTCATCGACGCGTTGGTTCGACGATGACCAACTCAAGGCC
GATATTGAGCTGCAGCAATCCCTCATGAAAAAAGACAAGTCGCTTCACCAGTTATATGTCAACGCCGTCGATGCA
AAGCCTGAGTCCGTATCCACCGCTGCCTTTAATTCTCAATTTTGGTCTTCACGCACGGATCGTTTGCGACTTCAC
GCTATTGACCTGAACCAAAAAAGAGGTGCCTATAATGTGCTGTCAACGGTCAAGCCTCGAACCGTTGACGGTGAG
CTCAAGCTTAACATTAGCGTCGAACAAGTGCAAATGATTTTGGAACAGCATCCTCTTATTAAACGCATCTATAAT
GAAAACGTCCCCAAGATTTCAGAGGCTCAGTTTTGGTCTCGATTCTTTCTCAGTAGGCTCTCCAAACAGCTTCGA
GGCGAGCGCGTCTCTGAATCGGAGCGTCCTGATCCCTTATTCGACAAGCACGACGTGAGCGAAAACACACAGAGT
TTTCAGAATATGATAATAGCCCGGAGTGTCCCACGCATCATCGACGTCGAAGCAAACGAAGAGAACCAAGGAGGC
TTTAGGAGCGGAAATGCCAAAGATGTGGAAATGAGGCCACGGGCCAACATATCCATTGGAAAAACGTTTAACAGC
CTCAGTCAGAGCATAATGGCAAATGCGGCCCCCTCAGATGGCAACCAGGGCGACCCGCAGGGCAGCTTTGACACG
TTGAATCAACTGATGCTACACGATCTCCAAGGCGATCGTCAGCAGGAGCGCATCATGCTCAACGTTCGAGAACAA
AATAGGTCTTTCTTCAGCCGTGATTCTACTGCGCCCACTGCCAATGAGCGCATATTTGCCAAGCAGGACCCTAGA
CAAGTCCTTGAAGCTTTCAAAGCTTCCCTTGACCAATTGGATACATATGGCCCCGACAGGACGGCGCTCCAGGCT
CTCATTGACTTTGACGACGAGAGCAACAGCGACGAAGAAGAGCAGAGAAAGTCGCCCTTTGGCTCCCGTGCAGCA
TACAACGCTGCGGAAAAGGAGATCATGGACCGCATCCGTCAGCAACGGTCAAAAGAATACGGCCACGATGGCGAC
GTCACATCACCCATGGGCCTGTCGCCAGTCATGACAGAAAAATGCACCTTGGCACATGCAACGACTATAGAGTTT
TTGCGCCAGTTTTGGAATGCCTTTCTCTCTGGCGATGCCAACCGTGCCCTCGAATTACAGTATCTGGCACAGTCG
CTCAGTCAATCGGCCACTCGCCTGGCCGCCGTGGCGGACGAAGCCGAGGTGGAGCGTGAAGCAGCGATTCGCCAG
CGCAAGCATGACATTCGCATTCACTTTGAACGTACCGGGAAAAGACTCAAGTGGAAGTCGGACATGGTTGGGGGC
GGACGCGATGCTGTCAACAACCTCTATCGGCCCACCTTTATTACTCTGGAAAAGGCGCAGCACGAGTACGCCAAG
GCCCTCGAGGCTGAAGGGATTCAGGCTTCTACCGAGTAA
Gene >OphauG2|4141
ATGGCCATTCCCGCCGGGCGCACTCTTTTCAAAAAGAAAGATGGCATCCTCACCTTAACGCCCGACCGCCGAACC
CTGACATGGACTCCAAACACGGGCGGTCCTCCCACGGTGTCCCTGCCCGTTGCGAGCATCACCAGCACGTCTCGC
CAAATCTTGTCCCCTCCTCCTCCTAGCCATGATTGGTCTAATCCTTGACTCTGTTTTAGACCTTCAGCAGACGCC
AGACACGTCGCCCAAGGTGATGCTCAAGGTTTTTCAAAAGTCAGAAACCGGCGGTGATGCCGTCCCGTATTTATT
CCACTTCAACACCAGCGAAGCTCGAGCAGAAGCCAAGGTCCTCAAGGACATTCTCTCTACTTTTTTGACCGATCT
GCGAAGCAATGAAGTCCCACGGCCCGCTGGAGCCGACACTCCTTCTGCCGCCTCGGGCAGTGCCTCGGCCTCGAT
GGCTTTTGCCAGTGCTGTCAATTCGCATCCGTCATCGACGCGTTGGTTCGACGATGACCAACTCAAGGCCGATAT
TGAGCTGCAGCAATCCCTCATGAAAAAAGACAAGTCGCTTCACCAGTTATATGTCAACGCCGTCGATGCAAAGCC
TGAGTCCGTATCCACCGCTGCCTTTAATTCTCAATTTTGGTCTTCACGCACGGATCGTTTGCGACTTCACGCTAT
TGACCTGAACCAAAAAAGAGGTGCCTATAATGTGCTGTCAACGGTCAAGCCTCGAACCGTTGACGGTGAGCTCAA
GCTTAACATTAGCGTCGAACAAGTGCAAATGATTTTGGAACAGCATCCTCTTATTAAACGCATCTATAATGAAAA
CGTCCCCAAGATTTCAGAGGCTCAGTTTTGGTCTCGATTCTTTCTCAGTAGGCTCTCCAAACAGCTTCGAGGCGA
GCGCGTCTCTGAATCGGAGCGTCCTGATCCCTTATTCGACAAGCACGACGTGAGCGAAAACACACAGAGTTTTCA
GAATATGATAATAGCCCGGAGTGTCCCACGCATCATCGACGTCGAAGCAAACGAAGAGAACCAAGGAGGCTTTAG
GAGCGGAAATGCCAAAGATGTGGAAATGAGGCCACGGGCCAACATATCCATTGGAAAAACGTTTAACAGCCTCAG
TCAGAGCATAATGGCAAATGCGGCCCCCTCAGATGGCAACCAGGGCGACCCGCAGGGCAGCTTTGACACGTTGAA
TCAACTGATGCTACACGATCTCCAAGGCGATCGTCAGCAGGAGCGCATCATGCTCAACGTTCGAGAACAAAATAG
GTCTTTCTTCAGCCGTGATTCTACTGCGCCCACTGCCAATGAGCGCATATTTGCCAAGCAGGACCCTAGACAAGT
CCTTGAAGCTTTCAAAGCTTCCCTTGACCAATTGGATACATATGGCCCCGACAGGACGGCGCTCCAGGCTCTCAT
TGACTTTGACGACGAGAGCAACAGCGACGAAGAAGAGCAGAGAAAGTCGCCCTTTGGCTCCCGTGCAGCATACAA
CGCTGCGGAAAAGGAGATCATGGACCGCATCCGTCAGCAACGGTCAAAAGAATACGGCCACGATGGCGACGTCAC
ATCACCCATGGGCCTGTCGCCAGTCATGACAGAAAAATGCACCTTGGCACATGCAACGACTATAGAGTTTTTGCG
CCAGTTTTGGAATGCCTTTCTCTCTGGCGATGCCAACCGTGCCCTCGAATTACAGTATCTGGCACAGTCGCTCAG
TCAATCGGCCACTCGCCTGGCCGCCGTGGCGGACGAAGCCGAGGTGGAGCGTGAAGCAGCGATTCGCCAGCGCAA
GCATGACATTCGCATTCACTTTGAACGTACCGGGAAAAGACTCAAGTGGAAGTCGGACATGGTTGGGGGCGGACG
CGATGCTGTCAACAACCTCTATCGGCCCACCTTTATTACTCTGGAAAAGGCGCAGCACGAGTACGCCAAGGCCCT
CGAGGCTGAAGGGATTCAGGCTTCTACCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail