Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4133
Gene name
LocationContig_334:61..3282
Strand-
Gene length (bp)3221
Transcript length (bp)3069
Coding sequence length (bp)3069
Protein length (aa) 1023

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19282 Exportin-T Exportin-T 1.1E-300 337 1020
PF08389 Xpo1 Exportin 1-like protein 2.6E-32 106 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QMS5|XPOT_ASPNC Exportin-T OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=los1 PE=3 SV=1 1 1020 0.0E+00
sp|Q2H6R9|XPOT_CHAGB Exportin-T OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LOS1 PE=3 SV=1 1 1022 0.0E+00
sp|Q0V6W0|XPOT_PHANO Exportin-T OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LOS1 PE=3 SV=1 1 997 0.0E+00
sp|Q0CIL3|XPOT_ASPTN Exportin-T OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=los1 PE=3 SV=2 1 1020 0.0E+00
sp|Q5ASE3|XPOT_EMENI Exportin-T OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=los1 PE=3 SV=1 1 1015 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QMS5|XPOT_ASPNC Exportin-T OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=los1 PE=3 SV=1 1 1020 0.0E+00
sp|Q2H6R9|XPOT_CHAGB Exportin-T OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LOS1 PE=3 SV=1 1 1022 0.0E+00
sp|Q0V6W0|XPOT_PHANO Exportin-T OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LOS1 PE=3 SV=1 1 997 0.0E+00
sp|Q0CIL3|XPOT_ASPTN Exportin-T OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=los1 PE=3 SV=2 1 1020 0.0E+00
sp|Q5ASE3|XPOT_EMENI Exportin-T OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=los1 PE=3 SV=1 1 1015 0.0E+00
sp|B0Y4D6|XPOT_ASPFC Exportin-T OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=los1 PE=3 SV=2 1 1015 0.0E+00
sp|A1DEK2|XPOT_NEOFI Exportin-T OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=los1 PE=3 SV=2 1 1015 0.0E+00
sp|Q4WUV9|XPOT_ASPFU Exportin-T OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=los1 PE=3 SV=2 1 1015 0.0E+00
sp|A1CAU2|XPOT_ASPCL Exportin-T OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=los1 PE=3 SV=1 1 1020 0.0E+00
sp|Q2U3V3|XPOT_ASPOR Exportin-T OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=los1 PE=3 SV=2 1 1015 0.0E+00
sp|Q1DY99|XPOT_COCIM Exportin-T OS=Coccidioides immitis (strain RS) GN=LOS1 PE=3 SV=1 1 1020 0.0E+00
sp|A6RVT8|XPOT_BOTFB Exportin-T OS=Botryotinia fuckeliana (strain B05.10) GN=los1 PE=3 SV=2 1 1022 0.0E+00
sp|A7EPT5|XPOT_SCLS1 Exportin-T OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=los1 PE=3 SV=1 1 1022 0.0E+00
sp|B2AXG6|XPOT_PODAN Exportin-T OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LOS1 PE=3 SV=2 1 1022 0.0E+00
sp|A4RMB1|XPOT_MAGO7 Exportin-T OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LOS1 PE=3 SV=2 1 1022 0.0E+00
sp|Q7RWV9|XPOT_NEUCR Exportin-T OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=los1 PE=3 SV=2 1 1022 0.0E+00
sp|O94258|XPOT_SCHPO Exportin-T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=los1 PE=1 SV=1 1 1021 1.0E-134
sp|Q6C715|XPOT_YARLI Exportin-T OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LOS1 PE=3 SV=1 1 1020 2.0E-123
sp|B0DAD3|XPOT_LACBS Exportin-T OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LOS1 PE=3 SV=1 4 1021 2.0E-104
sp|Q4PC84|XPOT_USTMA Exportin-T OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LOS1 PE=3 SV=2 1 1022 3.0E-100
sp|A8NU66|XPOT_COPC7 Exportin-T OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LOS1 PE=3 SV=2 4 1021 6.0E-98
sp|A5DLM5|XPOT_PICGU Exportin-T OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=LOS1 PE=3 SV=2 1 1015 3.0E-97
sp|A3LWK3|XPOT_PICST Exportin-T OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=LOS1 PE=3 SV=2 1 997 8.0E-96
sp|Q5A0E2|XPOT_CANAL Exportin-T OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LOS1 PE=3 SV=1 1 997 3.0E-93
sp|A5E7I7|XPOT_LODEL Exportin-T OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LOS1 PE=3 SV=1 1 997 5.0E-91
sp|Q6BL58|XPOT_DEBHA Exportin-T OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LOS1 PE=3 SV=2 1 1015 7.0E-90
sp|O43592|XPOT_HUMAN Exportin-T OS=Homo sapiens GN=XPOT PE=1 SV=2 14 1016 2.0E-87
sp|Q5RA02|XPOT_PONAB Exportin-T OS=Pongo abelii GN=XPOT PE=2 SV=1 14 1016 2.0E-86
sp|Q9CRT8|XPOT_MOUSE Exportin-T OS=Mus musculus GN=Xpot PE=1 SV=3 14 1016 1.0E-84
sp|Q5SPJ8|XPOT_DANRE Exportin-T OS=Danio rerio GN=xpot PE=3 SV=1 14 985 1.0E-81
sp|Q6CV83|XPOT_KLULA Exportin-T OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LOS1 PE=3 SV=1 3 972 4.0E-81
sp|Q753A0|XPOT_ASHGO Exportin-T OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LOS1 PE=3 SV=2 1 1020 2.0E-78
sp|A8Q513|XPOT_MALGO Exportin-T OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=LOS1 PE=3 SV=2 2 988 1.0E-77
sp|P0CN64|XPOT_CRYNJ Exportin-T OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LOS1 PE=3 SV=1 14 950 5.0E-75
sp|P0CN65|XPOT_CRYNB Exportin-T OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LOS1 PE=3 SV=1 14 950 5.0E-75
sp|A7TE19|XPOT_VANPO Exportin-T OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=LOS1 PE=3 SV=1 1 976 3.0E-71
sp|A7A084|XPOT_YEAS7 Exportin-T OS=Saccharomyces cerevisiae (strain YJM789) GN=LOS1 PE=3 SV=1 1 873 9.0E-69
sp|P33418|XPOT_YEAST Exportin-T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LOS1 PE=1 SV=1 1 873 1.0E-68
sp|Q6FNE9|XPOT_CANGA Exportin-T OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LOS1 PE=3 SV=1 1 951 3.0E-59
sp|Q7PC79|XPOT_ARATH Exportin-T OS=Arabidopsis thaliana GN=PSD PE=2 SV=1 5 1021 2.0E-54
sp|Q8H3A7|XPOT_ORYSJ Exportin-T OS=Oryza sativa subsp. japonica GN=Os07g0613300 PE=2 SV=1 106 977 2.0E-37
sp|Q54RI9|XPOT_DICDI Exportin-T OS=Dictyostelium discoideum GN=xpot PE=3 SV=1 471 1022 6.0E-31
sp|Q54RI9|XPOT_DICDI Exportin-T OS=Dictyostelium discoideum GN=xpot PE=3 SV=1 4 460 5.0E-24
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4133
MEAQVENAVNILSNPGADQGLQLQAFDFLNQLRADPTGWQTCTQLFSRSTAASEVARMVCLEVVNYAVHTQGLDA
ESLAYLKYTFFQYVRQGYGPDAHRDPDSVPLQNKLTQTLTYLFVFLYQHGWESFLDDFWDLTGIPGNTANPAGVL
LYLRILSSIHDEIADMLLVRDGSEPKRKNELKDLVRARDMHKVAQAWRQLLMQYSSNDVVLELILKVIAKWVSWI
DISLIVTQDMLSQLLPVVGRSSQGGEDKVRDTAIDTLTEICGKKMRSADKMELLSFLNLREIVAQLLVSPSLNAF
KGTPQYGTDLAEVVAKLVNMAVSDIVRTLDDGQAGDDVHARAKQHLDDFLPFLLRFLSDEYDEVCSTVIPALTDL
LTFLRKLGQLPQSYSSMLPPILDTIVRKMRFDETMDWGNQDEQTDEAEFQDLRRKLQNLQKTIAAIDQSLYMDML
SNLVSTTFQRYQDMGLQNKEMDWRDLDLAMHEIYLFGELALPNHGIGTKNQPSSEALERLVVMMEKMIQCGIASF
GHPAIVLQYMEICVRYCVVFENHPEYIPQVLESFVNLVHHHHVRVRTRSWYLFHRLIKQLRTRLGDVADTVIRSI
ADLLPIKAVIPSDDADDDMSSDESDHSADALFTSQLYLFEAIGCISSNQSTPPEKQALYARSVMDPLFQDMEANL
PRAKSGDAQAVLQVHHIVQALGTLAHGFSGWTSGSTSQHALPAKAVSDEFSRAAEAILIALNQLNSSPEIRPACR
SSFSKLLGVLGVAVLPQLPQWIEGLLSQSSSKDEMAMFLRLLDQVVFGFKSEIYEVLNLLLTPLLQRIFAGLGEP
IAGTDDEIQLAELRREYLSFLQIILNNGLEGVLISEANQGFFEPLIVSITELAKTLDGNVGPSRLAFTLMSRIAV
IWGGADVATIAESPSAPGREPCPVIPGFDRFMIERFHSVCWEVMRNTGFKPWQDAQMKQILTEIANLEQIIYTKT
GDILIQELRNGFLANSGIDQDVFLRYLTSSTDKKAFAMYLQGLLKSR*
Coding >OphauG2|4133
ATGGAAGCTCAGGTCGAAAATGCCGTAAACATACTGTCCAACCCCGGTGCCGACCAAGGCCTCCAGCTACAGGCC
TTCGATTTTCTTAATCAGTTGCGCGCCGACCCTACCGGCTGGCAGACATGCACCCAACTCTTTTCCAGAAGCACT
GCAGCTTCCGAAGTGGCGCGCATGGTGTGTCTAGAAGTGGTCAATTATGCCGTCCATACTCAGGGCCTCGACGCC
GAAAGCTTGGCCTATCTCAAATATACCTTTTTCCAATATGTCCGCCAAGGCTATGGCCCAGACGCCCACCGAGAC
CCTGATTCTGTTCCCCTACAGAACAAACTCACTCAGACCTTGACCTATCTCTTTGTCTTCCTCTACCAACACGGC
TGGGAAAGCTTCCTCGATGACTTCTGGGATCTTACTGGCATCCCCGGAAACACGGCAAACCCAGCCGGCGTCCTC
CTTTACCTCCGAATTCTCTCCTCGATTCATGACGAAATTGCCGACATGCTGCTAGTCAGAGATGGCAGCGAGCCC
AAACGTAAGAATGAGCTCAAGGATCTTGTTCGTGCTCGAGATATGCACAAGGTTGCCCAGGCCTGGAGGCAGTTG
CTCATGCAATACTCGAGCAACGATGTTGTGCTTGAACTCATCCTCAAGGTCATCGCCAAGTGGGTCAGTTGGATC
GACATATCCCTTATTGTCACCCAGGATATGCTCAGCCAGCTACTACCCGTTGTTGGTCGCTCCAGTCAAGGCGGC
GAGGATAAAGTCCGCGATACTGCTATTGACACCTTGACGGAAATTTGCGGCAAGAAGATGAGGTCGGCCGACAAG
ATGGAGCTTCTATCATTTCTCAACTTGAGAGAAATTGTAGCACAGCTCCTCGTCAGTCCCTCGTTGAATGCCTTT
AAAGGAACCCCACAATACGGCACCGACTTGGCCGAGGTGGTGGCTAAGCTCGTCAATATGGCCGTCTCAGACATT
GTCAGGACACTTGACGACGGCCAGGCTGGCGACGATGTCCATGCTCGAGCCAAGCAGCATTTGGACGATTTTCTC
CCCTTTCTCCTGCGCTTCTTGTCAGACGAGTATGACGAGGTTTGCTCCACTGTTATTCCAGCTCTTACCGACCTC
CTTACATTCTTGAGAAAGCTGGGACAGCTGCCTCAGTCCTACTCGAGTATGCTTCCACCCATACTCGACACAATT
GTTCGCAAGATGCGCTTTGATGAGACAATGGATTGGGGCAACCAAGACGAACAGACAGACGAGGCTGAGTTTCAG
GACCTGCGAAGGAAGCTACAAAACCTTCAAAAGACAATTGCTGCTATTGACCAGTCTCTCTACATGGACATGCTG
AGCAACCTGGTGTCGACAACCTTCCAGAGATATCAAGACATGGGTCTGCAAAACAAGGAAATGGACTGGCGTGAT
CTCGACCTCGCCATGCACGAGATTTACCTGTTTGGAGAACTTGCTCTACCCAATCACGGCATCGGCACCAAGAAT
CAGCCGTCTAGTGAGGCTTTGGAAAGACTTGTTGTCATGATGGAAAAGATGATTCAGTGTGGCATAGCGAGCTTT
GGTCATCCTGCCATTGTGCTACAATACATGGAGATTTGTGTTCGTTATTGTGTCGTCTTCGAGAACCACCCCGAG
TATATTCCACAAGTACTAGAGAGCTTCGTCAATCTCGTACACCATCATCATGTACGAGTCAGGACCCGCTCTTGG
TATCTCTTTCACCGCCTCATCAAACAGTTGCGTACAAGGCTGGGAGACGTGGCGGATACCGTGATTCGGTCCATT
GCAGATCTGCTGCCCATCAAGGCGGTAATTCCAAGTGATGACGCCGACGACGATATGTCGTCGGACGAGTCGGAT
CATTCCGCAGATGCATTATTCACGAGCCAGCTTTATCTTTTTGAGGCCATTGGATGCATCTCATCCAACCAGAGC
ACCCCGCCTGAGAAGCAGGCACTGTATGCCCGGTCTGTCATGGATCCCTTGTTTCAAGACATGGAAGCAAATCTC
CCGCGAGCAAAGTCGGGAGATGCCCAGGCCGTGCTGCAGGTTCATCACATTGTCCAGGCACTGGGGACGCTGGCG
CACGGATTCTCTGGCTGGACGTCTGGGTCGACAAGTCAGCACGCACTGCCTGCAAAGGCTGTCTCTGATGAGTTC
TCGCGCGCAGCCGAGGCCATCTTGATTGCCTTGAATCAGCTCAATTCTTCGCCAGAGATTCGGCCCGCCTGTCGC
TCGTCCTTCTCCAAGCTCTTGGGTGTCTTGGGCGTTGCAGTGCTCCCGCAGCTTCCGCAGTGGATCGAGGGCTTG
CTGTCGCAGAGTTCTTCAAAAGACGAAATGGCCATGTTTTTGCGCCTGCTAGATCAGGTTGTTTTTGGATTTAAG
TCTGAGATTTACGAAGTGCTTAATCTGCTGCTCACGCCGCTTCTTCAGCGAATATTTGCCGGCTTGGGGGAGCCT
ATAGCGGGGACAGATGACGAGATCCAGCTGGCCGAACTTCGCAGAGAATATCTTTCGTTTCTACAGATTATTCTC
AACAATGGACTGGAGGGAGTCCTAATTAGCGAAGCAAACCAGGGCTTCTTTGAGCCTCTGATTGTCTCCATTACA
GAGCTTGCCAAGACTTTGGATGGCAATGTTGGCCCTAGTCGGCTGGCTTTTACCCTCATGTCACGCATTGCGGTG
ATTTGGGGGGGTGCAGACGTGGCGACGATTGCAGAGAGCCCCAGCGCTCCGGGCCGGGAGCCTTGCCCTGTTATT
CCTGGCTTTGACCGCTTCATGATTGAACGCTTCCATAGTGTGTGCTGGGAGGTGATGCGCAATACTGGATTCAAG
CCCTGGCAGGACGCGCAAATGAAGCAGATATTGACGGAAATTGCAAACCTGGAGCAAATAATTTACACCAAGACT
GGCGACATACTGATCCAGGAGCTCCGCAATGGCTTCTTGGCCAACTCGGGCATTGACCAAGACGTGTTTCTGAGA
TATTTGACGTCTTCGACGGACAAGAAGGCCTTTGCCATGTATTTGCAAGGTCTGTTGAAGTCTCGGTAA
Transcript >OphauG2|4133
ATGGAAGCTCAGGTCGAAAATGCCGTAAACATACTGTCCAACCCCGGTGCCGACCAAGGCCTCCAGCTACAGGCC
TTCGATTTTCTTAATCAGTTGCGCGCCGACCCTACCGGCTGGCAGACATGCACCCAACTCTTTTCCAGAAGCACT
GCAGCTTCCGAAGTGGCGCGCATGGTGTGTCTAGAAGTGGTCAATTATGCCGTCCATACTCAGGGCCTCGACGCC
GAAAGCTTGGCCTATCTCAAATATACCTTTTTCCAATATGTCCGCCAAGGCTATGGCCCAGACGCCCACCGAGAC
CCTGATTCTGTTCCCCTACAGAACAAACTCACTCAGACCTTGACCTATCTCTTTGTCTTCCTCTACCAACACGGC
TGGGAAAGCTTCCTCGATGACTTCTGGGATCTTACTGGCATCCCCGGAAACACGGCAAACCCAGCCGGCGTCCTC
CTTTACCTCCGAATTCTCTCCTCGATTCATGACGAAATTGCCGACATGCTGCTAGTCAGAGATGGCAGCGAGCCC
AAACGTAAGAATGAGCTCAAGGATCTTGTTCGTGCTCGAGATATGCACAAGGTTGCCCAGGCCTGGAGGCAGTTG
CTCATGCAATACTCGAGCAACGATGTTGTGCTTGAACTCATCCTCAAGGTCATCGCCAAGTGGGTCAGTTGGATC
GACATATCCCTTATTGTCACCCAGGATATGCTCAGCCAGCTACTACCCGTTGTTGGTCGCTCCAGTCAAGGCGGC
GAGGATAAAGTCCGCGATACTGCTATTGACACCTTGACGGAAATTTGCGGCAAGAAGATGAGGTCGGCCGACAAG
ATGGAGCTTCTATCATTTCTCAACTTGAGAGAAATTGTAGCACAGCTCCTCGTCAGTCCCTCGTTGAATGCCTTT
AAAGGAACCCCACAATACGGCACCGACTTGGCCGAGGTGGTGGCTAAGCTCGTCAATATGGCCGTCTCAGACATT
GTCAGGACACTTGACGACGGCCAGGCTGGCGACGATGTCCATGCTCGAGCCAAGCAGCATTTGGACGATTTTCTC
CCCTTTCTCCTGCGCTTCTTGTCAGACGAGTATGACGAGGTTTGCTCCACTGTTATTCCAGCTCTTACCGACCTC
CTTACATTCTTGAGAAAGCTGGGACAGCTGCCTCAGTCCTACTCGAGTATGCTTCCACCCATACTCGACACAATT
GTTCGCAAGATGCGCTTTGATGAGACAATGGATTGGGGCAACCAAGACGAACAGACAGACGAGGCTGAGTTTCAG
GACCTGCGAAGGAAGCTACAAAACCTTCAAAAGACAATTGCTGCTATTGACCAGTCTCTCTACATGGACATGCTG
AGCAACCTGGTGTCGACAACCTTCCAGAGATATCAAGACATGGGTCTGCAAAACAAGGAAATGGACTGGCGTGAT
CTCGACCTCGCCATGCACGAGATTTACCTGTTTGGAGAACTTGCTCTACCCAATCACGGCATCGGCACCAAGAAT
CAGCCGTCTAGTGAGGCTTTGGAAAGACTTGTTGTCATGATGGAAAAGATGATTCAGTGTGGCATAGCGAGCTTT
GGTCATCCTGCCATTGTGCTACAATACATGGAGATTTGTGTTCGTTATTGTGTCGTCTTCGAGAACCACCCCGAG
TATATTCCACAAGTACTAGAGAGCTTCGTCAATCTCGTACACCATCATCATGTACGAGTCAGGACCCGCTCTTGG
TATCTCTTTCACCGCCTCATCAAACAGTTGCGTACAAGGCTGGGAGACGTGGCGGATACCGTGATTCGGTCCATT
GCAGATCTGCTGCCCATCAAGGCGGTAATTCCAAGTGATGACGCCGACGACGATATGTCGTCGGACGAGTCGGAT
CATTCCGCAGATGCATTATTCACGAGCCAGCTTTATCTTTTTGAGGCCATTGGATGCATCTCATCCAACCAGAGC
ACCCCGCCTGAGAAGCAGGCACTGTATGCCCGGTCTGTCATGGATCCCTTGTTTCAAGACATGGAAGCAAATCTC
CCGCGAGCAAAGTCGGGAGATGCCCAGGCCGTGCTGCAGGTTCATCACATTGTCCAGGCACTGGGGACGCTGGCG
CACGGATTCTCTGGCTGGACGTCTGGGTCGACAAGTCAGCACGCACTGCCTGCAAAGGCTGTCTCTGATGAGTTC
TCGCGCGCAGCCGAGGCCATCTTGATTGCCTTGAATCAGCTCAATTCTTCGCCAGAGATTCGGCCCGCCTGTCGC
TCGTCCTTCTCCAAGCTCTTGGGTGTCTTGGGCGTTGCAGTGCTCCCGCAGCTTCCGCAGTGGATCGAGGGCTTG
CTGTCGCAGAGTTCTTCAAAAGACGAAATGGCCATGTTTTTGCGCCTGCTAGATCAGGTTGTTTTTGGATTTAAG
TCTGAGATTTACGAAGTGCTTAATCTGCTGCTCACGCCGCTTCTTCAGCGAATATTTGCCGGCTTGGGGGAGCCT
ATAGCGGGGACAGATGACGAGATCCAGCTGGCCGAACTTCGCAGAGAATATCTTTCGTTTCTACAGATTATTCTC
AACAATGGACTGGAGGGAGTCCTAATTAGCGAAGCAAACCAGGGCTTCTTTGAGCCTCTGATTGTCTCCATTACA
GAGCTTGCCAAGACTTTGGATGGCAATGTTGGCCCTAGTCGGCTGGCTTTTACCCTCATGTCACGCATTGCGGTG
ATTTGGGGGGGTGCAGACGTGGCGACGATTGCAGAGAGCCCCAGCGCTCCGGGCCGGGAGCCTTGCCCTGTTATT
CCTGGCTTTGACCGCTTCATGATTGAACGCTTCCATAGTGTGTGCTGGGAGGTGATGCGCAATACTGGATTCAAG
CCCTGGCAGGACGCGCAAATGAAGCAGATATTGACGGAAATTGCAAACCTGGAGCAAATAATTTACACCAAGACT
GGCGACATACTGATCCAGGAGCTCCGCAATGGCTTCTTGGCCAACTCGGGCATTGACCAAGACGTGTTTCTGAGA
TATTTGACGTCTTCGACGGACAAGAAGGCCTTTGCCATGTATTTGCAAGGTCTGTTGAAGTCTCGGTAA
Gene >OphauG2|4133
ATGGAAGCTCAGGTTCGCCGCCCTTGGGCTCTCCATCCTCCCTCGCATCTATTTAGCACCTCCCACACCAGGCGT
CCTGACTGACGTGCCATTAGGTCGAAAATGCCGTAAACATACTGTCCAACCCCGGTGCCGACCAAGGCCTCCAGC
TACAGGCCTTCGATTTTCTTAATCAGTTGCGCGCCGACCCTACCGGCTGGCAGACATGCACCCAACTCTTTTCCA
GAAGCACTGCAGCTTCCGAAGTGGCGCGCATGGTGTGTCTAGAAGTGGTCAATTATGCCGTCCATACTCAGGGCC
TCGACGCCGAAAGCTTGGCCTATCTCAAATATACCTTTTTCCAATATGTCCGCCAAGGCTATGGCCCAGACGCCC
ACCGAGACCCTGATTCTGTTCCCCTACAGAACAAACTCACTCAGACCTTGACCTATCTCTTTGTCTTCCTCTACC
AACACGGCTGGGAAAGCTTCCTCGATGACTTCTGGGATCTTACTGGCATCCCCGGAAACACGGCAAACCCAGCCG
GCGTCCTCCTTTACCTCCGAATTCTCTCCTCGATTCATGACGAAATTGCCGACATGCTGCTAGTCAGAGATGGCA
GCGAGCCCAAACGTAAGAATGAGCTCAAGGATCTTGTTCGTGCTCGAGATATGCACAAGGTTGCCCAGGCCTGGA
GGCAGTTGCTCATGCAATACTCGAGCAACGATGTTGTGCTTGAACTCATCCTCAAGGTCATCGCCAAGTGGGTCA
GTTGGATCGACATATCCCTTATTGTCACCCAGGATATGCTCAGCCAGCTACTACCCGTTGTTGGTCGCTCCAGTC
AAGGCGGCGAGGATAAAGTCCGCGATACTGCTATTGACACCTTGACGGAAATTTGCGGCAAGAAGATGAGGTCGG
CCGACAAGATGGAGCTTCTATCATTTCTCAACTTGAGAGAAATTGTAGCACAGCTCCTCGTCAGTCCCTCGTTGA
ATGCCTTTAAAGGAACCCCACAATACGGCACCGACTTGGCCGAGGTGGTGGCTAAGCTCGTCAATATGGCCGTCT
CAGACATTGTCAGGACACTTGACGACGGCCAGGCTGGCGACGATGTCCATGCTCGAGCCAAGCAGCATTTGGACG
ATTTTCTCCCCTTTCTCCTGCGCTTCTTGTCAGACGAGTATGACGAGGTTTGCTCCACTGTTATTCCAGCTCTTA
CCGACCTCCTTACATTCTTGAGAAAGCTGGGACAGCTGCCTCAGTCCTACTCGAGTATGCTTCCACCCATACTCG
ACACAATTGTTCGCAAGATGCGCTTTGATGAGACAATGGATTGGGGCAACCAAGACGAACAGACAGACGAGGCTG
AGTTTCAGGACCTGCGAAGGAAGCTACAAAACCTTCAAAAGACAATTGCTGCTATTGACCAGTCTCTCTACATGG
ACATGCTGAGCAACCTGGTGTCGACAACCTTCCAGAGATATCAAGACATGGGTCTGCAAAACAAGGAAATGGACT
GGCGTGATCTCGACCTCGCCATGCACGAGATTTACCTGTTTGGAGAACTTGCTCTACCCAATCACGGCATCGGCA
CCAAGAATCAGCCGTCTAGTGAGGCTTTGGAAAGACTTGTTGTCATGATGGAAAAGATGATTCAGTGTGGTGAGT
CTTGATCAAATCCCTCGGCTACTGGGCTCAATGCAGAAAGGCTGATGCATCTTGTCTTTTTAGGCATAGCGAGCT
TTGGTCATCCTGCCATTGTGCTACAATACATGGAGATTTGTGTTCGTTATTGTGTCGTCTTCGAGAACCACCCCG
AGTATATTCCACAAGTACTAGAGAGCTTCGTCAATCTCGTACACCATCATCATGTACGAGTCAGGACCCGCTCTT
GGTATCTCTTTCACCGCCTCATCAAACAGTTGCGTACAAGGCTGGGAGACGTGGCGGATACCGTGATTCGGTCCA
TTGCAGATCTGCTGCCCATCAAGGCGGTAATTCCAAGTGATGACGCCGACGACGATATGTCGTCGGACGAGTCGG
ATCATTCCGCAGATGCATTATTCACGAGCCAGCTTTATCTTTTTGAGGCCATTGGATGCATCTCATCCAACCAGA
GCACCCCGCCTGAGAAGCAGGCACTGTATGCCCGGTCTGTCATGGATCCCTTGTTTCAAGACATGGAAGCAAATC
TCCCGCGAGCAAAGTCGGGAGATGCCCAGGCCGTGCTGCAGGTTCATCACATTGTCCAGGCACTGGGGACGCTGG
CGCACGGATTCTCTGGCTGGACGTCTGGGTCGACAAGTCAGCACGCACTGCCTGCAAAGGCTGTCTCTGATGAGT
TCTCGCGCGCAGCCGAGGCCATCTTGATTGCCTTGAATCAGCTCAATTCTTCGCCAGAGATTCGGCCCGCCTGTC
GCTCGTCCTTCTCCAAGCTCTTGGGTGTCTTGGGCGTTGCAGTGCTCCCGCAGCTTCCGCAGTGGATCGAGGGCT
TGCTGTCGCAGAGTTCTTCAAAAGACGAAATGGCCATGTTTTTGCGCCTGCTAGATCAGGTTGTTTTTGGATTTA
AGTCTGAGATTTACGAAGTGCTTAATCTGCTGCTCACGCCGCTTCTTCAGCGAATATTTGCCGGCTTGGGGGAGC
CTATAGCGGGGACAGATGACGAGATCCAGCTGGCCGAACTTCGCAGAGAATATCTTTCGTTTCTACAGATTATTC
TCAACAATGGACTGGAGGGAGTCCTAATTAGCGAAGCAAACCAGGGCTTCTTTGAGCCTCTGATTGTCTCCATTA
CAGAGCTTGCCAAGACTTTGGATGGCAATGTTGGCCCTAGTCGGCTGGCTTTTACCCTCATGTCACGCATTGCGG
TGATTTGGGGGGGTGCAGACGTGGCGACGATTGCAGAGAGCCCCAGCGCTCCGGGCCGGGAGCCTTGCCCTGTTA
TTCCTGGCTTTGACCGCTTCATGATTGAACGCTTCCATAGTGTGTGCTGGGAGGTGATGCGCAATACTGGATTCA
AGCCCTGGCAGGACGCGCAAATGAAGCAGATATTGACGGAAATTGCAAACCTGGAGCAAATAATTTACACCAAGA
CTGGCGACATACTGATCCAGGAGCTCCGCAATGGCTTCTTGGCCAACTCGGGCATTGACCAAGACGTGTTTCTGA
GATATTTGACGTCTTCGACGGACAAGAAGGCCTTTGCCATGTATTTGCAAGGTCTGTTGAAGTCTCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail