Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4129
Gene name
LocationContig_333:5296..6486
Strand-
Gene length (bp)1190
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0DN32|CUPR1_ARTBC Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 57 159 7.0E-12
sp|D4B3I5|A3024_ARTBC Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 46 164 3.0E-10
sp|Q9FL76|EXP24_ARATH Expansin-A24 OS=Arabidopsis thaliana GN=EXPA24 PE=2 SV=2 243 310 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4129
MQLLISLALATVATARPQSGIRPLDKTFGVRSNGRILSRATSNRLIPVVVGGPQDLFVPNMVFANIGDVVQFQFS
NGNHTVTQSNPDEGCQPLQLKDPSAVHSGHIPFQDGQTEVGTFNMPVTNIDPMFLYCATGPHCQIGQVMVVNPAS
SDQIVQYSKVSQMAKENVDAGGVSGGTVGKIPIAAAAFVPAPPEEKEPGGGEGADKAPAPAPTSAPPPAATSAAP
TKGEPSKGEPSKGEPSKGGEPAMGAEPAQGANPSKGSNPAMGAQPAKGGEPAMGAEPAMGAQPAKGGEPAMGAEP
ATGANPANGGAGTEAPEVSGGEPGAETGGETRLPNGSLPSEG*
Coding >OphauG2|4129
ATGCAGCTACTCATCTCTCTCGCGCTGGCGACAGTGGCCACTGCCCGGCCTCAGTCTGGAATAAGGCCTTTGGAC
AAGACATTTGGAGTGCGCTCAAATGGCCGTATTCTCTCTCGAGCAACAAGTAATCGACTTATCCCCGTGGTTGTT
GGAGGGCCGCAAGACTTGTTTGTGCCAAACATGGTCTTTGCCAATATTGGCGACGTGGTGCAGTTTCAGTTCAGC
AATGGCAACCACACCGTGACACAAAGTAATCCCGACGAAGGATGCCAGCCGCTGCAGCTCAAGGATCCCTCGGCT
GTTCACAGCGGACACATTCCCTTCCAGGACGGCCAAACCGAAGTCGGAACCTTTAACATGCCCGTCACCAACATC
GATCCCATGTTTCTCTACTGTGCTACTGGGCCTCATTGCCAGATTGGCCAGGTCATGGTGGTGAACCCAGCAAGC
TCGGATCAAATCGTTCAATATTCCAAGGTTTCGCAAATGGCAAAGGAAAATGTAGACGCTGGCGGTGTTTCTGGC
GGCACGGTTGGCAAGATTCCCATCGCCGCCGCCGCCTTTGTGCCTGCGCCACCAGAGGAAAAGGAGCCTGGTGGT
GGTGAAGGCGCTGACAAGGCTCCTGCTCCGGCACCTACGTCTGCGCCACCTCCAGCTGCGACTTCTGCTGCACCG
ACCAAGGGGGAGCCATCCAAGGGGGAGCCATCCAAGGGGGAGCCATCCAAAGGTGGTGAACCAGCAATGGGCGCT
GAGCCTGCCCAGGGCGCCAATCCATCCAAGGGATCCAATCCAGCAATGGGCGCCCAGCCAGCAAAAGGTGGTGAA
CCAGCCATGGGTGCTGAGCCGGCAATGGGTGCCCAGCCAGCCAAAGGTGGTGAACCGGCAATGGGCGCTGAGCCT
GCAACGGGTGCCAATCCAGCCAATGGAGGAGCCGGTACGGAGGCGCCCGAGGTGAGTGGTGGCGAGCCTGGAGCA
GAGACTGGTGGAGAAACTAGACTGCCAAATGGGTCACTGCCTTCGGAAGGCTAG
Transcript >OphauG2|4129
ATGCAGCTACTCATCTCTCTCGCGCTGGCGACAGTGGCCACTGCCCGGCCTCAGTCTGGAATAAGGCCTTTGGAC
AAGACATTTGGAGTGCGCTCAAATGGCCGTATTCTCTCTCGAGCAACAAGTAATCGACTTATCCCCGTGGTTGTT
GGAGGGCCGCAAGACTTGTTTGTGCCAAACATGGTCTTTGCCAATATTGGCGACGTGGTGCAGTTTCAGTTCAGC
AATGGCAACCACACCGTGACACAAAGTAATCCCGACGAAGGATGCCAGCCGCTGCAGCTCAAGGATCCCTCGGCT
GTTCACAGCGGACACATTCCCTTCCAGGACGGCCAAACCGAAGTCGGAACCTTTAACATGCCCGTCACCAACATC
GATCCCATGTTTCTCTACTGTGCTACTGGGCCTCATTGCCAGATTGGCCAGGTCATGGTGGTGAACCCAGCAAGC
TCGGATCAAATCGTTCAATATTCCAAGGTTTCGCAAATGGCAAAGGAAAATGTAGACGCTGGCGGTGTTTCTGGC
GGCACGGTTGGCAAGATTCCCATCGCCGCCGCCGCCTTTGTGCCTGCGCCACCAGAGGAAAAGGAGCCTGGTGGT
GGTGAAGGCGCTGACAAGGCTCCTGCTCCGGCACCTACGTCTGCGCCACCTCCAGCTGCGACTTCTGCTGCACCG
ACCAAGGGGGAGCCATCCAAGGGGGAGCCATCCAAGGGGGAGCCATCCAAAGGTGGTGAACCAGCAATGGGCGCT
GAGCCTGCCCAGGGCGCCAATCCATCCAAGGGATCCAATCCAGCAATGGGCGCCCAGCCAGCAAAAGGTGGTGAA
CCAGCCATGGGTGCTGAGCCGGCAATGGGTGCCCAGCCAGCCAAAGGTGGTGAACCGGCAATGGGCGCTGAGCCT
GCAACGGGTGCCAATCCAGCCAATGGAGGAGCCGGTACGGAGGCGCCCGAGGTGAGTGGTGGCGAGCCTGGAGCA
GAGACTGGTGGAGAAACTAGACTGCCAAATGGGTCACTGCCTTCGGAAGGCTAG
Gene >OphauG2|4129
ATGCAGCTACTCATCTCTCTCGCGCTGGCGACAGTGGCCACTGCCCGGCCTCAGTCTGGAATAAGGCCTTTGGAC
AAGACATTTGGAGGTTGGTGCTCATCCTTGGGCTAAGACAGGAGACAGCATCCCGATGGCTGACATTTTTTTTTG
TTTTTCTCTTGCTGCTCAACAGTGCGCTCAAATGGCCGTATTCTCTCTCGAGCAACAAGTAATCGACTTATCCCC
GTGGTTGTTGGAGGGCCGCAAGACTTGTTTGTGCCAAACATGGTCTTTGCCAATATTGGCGACGTGGTGCAGTTT
CAGTTCAGCAATGGCAACCACACCGTGACACAAAGTAATCCCGACGAAGGATGCCAGCCGCTGCAGCTCAAGGAT
CCCTCGGCTGTTCACAGCGGACACATTCCCTTCCAGGACGGCCAAACCGAAGTCGGAACCTTTAACATGCCCGTC
ACCAACATCGATCCCATGTTTCTCTACTGTGCTACTGGGCCTCATTGCCAGATTGGCCAGGTCATGGTGGTGAAC
CCGTAAGTCACACCTCGGCATTCTTTATATATATAATTCATTTGCTCGTCTATGGATGGTGAGTGCTGACAATGA
GCAGAGCAAGCTCGGATCAAATCGTTCAATATTCCAAGGTTTCGCAAATGGCAAAGGAAAATGTAGACGCTGGCG
GTGTTTCTGGCGGCACGGTTGGCAAGATTCCCATCGCCGCCGCCGCCTTTGTGCCTGCGCCACCAGAGGAAAAGG
AGCCTGGTGGTGGTGAAGGCGCTGACAAGGCTCCTGCTCCGGCACCTACGTCTGCGCCACCTCCAGCTGCGACTT
CTGCTGCACCGACCAAGGGGGAGCCATCCAAGGGGGAGCCATCCAAGGGGGAGCCATCCAAAGGTGGTGAACCAG
CAATGGGCGCTGAGCCTGCCCAGGGCGCCAATCCATCCAAGGGATCCAATCCAGCAATGGGCGCCCAGCCAGCAA
AAGGTGGTGAACCAGCCATGGGTGCTGAGCCGGCAATGGGTGCCCAGCCAGCCAAAGGTGGTGAACCGGCAATGG
GCGCTGAGCCTGCAACGGGTGCCAATCCAGCCAATGGAGGAGCCGGTACGGAGGCGCCCGAGGTGAGTGGTGGCG
AGCCTGGAGCAGAGACTGGTGGAGAAACTAGACTGCCAAATGGGTCACTGCCTTCGGAAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail