Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4122
Gene name
LocationContig_332:6008..8364
Strand+
Gene length (bp)2356
Transcript length (bp)1998
Coding sequence length (bp)1998
Protein length (aa) 666

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 6.4E-18 142 198
PF01591 6PF2K 6-phosphofructo-2-kinase 4.0E-45 246 409
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 3.3E-23 496 639

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 62 652 3.0E-146
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 115 652 6.0E-140
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 120 658 6.0E-109
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 148 656 9.0E-79
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 116 633 5.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 62 652 3.0E-146
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 115 652 6.0E-140
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 120 658 6.0E-109
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 148 656 9.0E-79
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 116 633 5.0E-76
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 116 633 1.0E-74
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 148 640 8.0E-73
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 148 642 4.0E-72
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 127 633 9.0E-72
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 248 634 6.0E-71
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 248 634 6.0E-71
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 248 633 9.0E-71
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 148 633 2.0E-70
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 247 640 5.0E-69
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 147 640 4.0E-68
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 250 633 1.0E-67
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 248 633 2.0E-67
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 247 633 1.0E-64
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 250 633 2.0E-64
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 250 633 2.0E-64
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 247 633 4.0E-64
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 247 633 2.0E-63
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 247 633 2.0E-63
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 250 633 1.0E-62
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 247 633 2.0E-61
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 275 632 2.0E-43
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 98 632 6.0E-33
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 263 417 9.0E-11
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 148 190 9.0E-10
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 148 190 1.0E-09
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 148 190 1.0E-09
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 148 189 6.0E-09
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 148 190 6.0E-09
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 117 193 9.0E-09
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 148 190 2.0E-08
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 148 190 2.0E-08
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 117 193 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006000 fructose metabolic process Yes
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016301 kinase activity No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019318 hexose metabolic process No
GO:0019200 carbohydrate kinase activity No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0008443 phosphofructokinase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0005996 monosaccharide metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3907
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4122 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7677
Ophiocordyceps camponoti-floridani Ophcf2|00493
Ophiocordyceps camponoti-rufipedis Ophun1|6505
Ophiocordyceps kimflemingae Ophio5|8196
Ophiocordyceps subramaniannii Hirsu2|7784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4122
MPAAVVIPQQVGQKQAKQSSLAKLVMNNNLALSSSPSVSLTSPQPDEAHPLSVQPPPPRNGNAAHDSPSAPTAQT
VRILHDLTDTPLSRSVNSTAPNSPRMPPQRQNSGSQTPRVRPHATTLNIPGMTRSRVSPDGRIPQRDVAAKLVIV
MVGLPARGKSYITKKLQRYLSWQQHDSRVFNVGNRRRNAVGIKVSRKSRLAPEPHRLDPPVQAATILLNGVPGQE
CTEPPELHLDGPCTSNCQVVDQSAKFFDPTNEQASALRNQVAMQTLEELLDYLLVQGGAVGILDATNSTIKRRQQ
IVDRIKAREPKLGILFIESICHDENLLEANMRLKLSGPDYRDKDPAQSLDDFKSRVAAYASAYQTLGKYEEDNDM
QYIQMIDVGRKLVQHRLRGFLSGGISTYLSSFNLAPRQIWITRHGQSMDNELGKLGGNSPITERGHCYGLALYKF
ITQRRKEWLMEQKSKIAQATFPPHPGDNTPPYPDMNHDLEQKNFCVWTSMLQRSVETAEYFDVDDDYDVKNWEML
NELNAGQFEGMTYEEIAQKYPDEFRKRSRDKLNYIYPGVGGEGYLQIISRLRDMVREIERITDHVLIIGHRSVCR
VLMAYFMDLTREDITDMDVPLGMLYSIEPKPYGIAFHAYKYDEARGWFDELPNYKPQKAGAIHPL*
Coding >OphauG2|4122
ATGCCGGCCGCCGTCGTCATCCCCCAGCAAGTCGGGCAGAAACAAGCAAAGCAATCGTCGCTGGCAAAACTTGTC
ATGAACAACAATCTCGCTCTCTCATCGTCGCCTTCAGTCTCGCTCACGTCTCCCCAACCCGATGAAGCCCATCCT
CTTTCCGTCCAGCCGCCGCCACCCCGCAATGGAAATGCTGCCCACGACTCCCCGTCTGCGCCCACGGCACAGACT
GTGCGGATTCTGCACGACTTGACGGATACGCCATTGTCCCGGAGCGTCAACTCGACTGCCCCAAACTCGCCGCGC
ATGCCTCCACAGCGTCAAAATTCGGGCAGCCAGACGCCTCGAGTCCGCCCACATGCCACAACGCTCAATATTCCC
GGCATGACGCGCTCCCGAGTTTCTCCCGATGGTCGCATCCCGCAGCGCGATGTCGCTGCCAAGCTTGTCATTGTC
ATGGTTGGCCTTCCCGCTCGCGGCAAATCCTACATTACAAAGAAGCTGCAGCGCTACCTCTCCTGGCAGCAGCAC
GACTCACGTGTCTTCAACGTTGGCAACCGCCGCCGCAATGCCGTCGGTATCAAGGTGTCGCGCAAATCGAGGCTG
GCGCCTGAACCCCATCGCCTCGACCCTCCAGTTCAGGCCGCCACGATTCTGCTCAATGGCGTTCCCGGCCAGGAA
TGCACCGAGCCCCCGGAGCTGCACCTCGACGGCCCTTGCACCTCCAACTGCCAAGTCGTTGACCAGTCGGCCAAG
TTTTTCGATCCCACCAATGAGCAGGCTTCTGCCCTGAGAAATCAGGTTGCCATGCAGACGCTTGAAGAACTGCTC
GACTACCTGCTTGTTCAGGGCGGTGCCGTTGGCATCCTCGACGCCACAAACAGCACCATCAAGCGCCGGCAGCAA
ATTGTTGACCGTATCAAGGCTCGAGAGCCCAAGCTTGGCATTCTCTTCATTGAGAGCATCTGCCACGACGAGAAC
CTGCTCGAAGCCAATATGCGCCTCAAGCTCTCGGGTCCTGACTATCGCGACAAAGACCCCGCACAGTCTCTTGAC
GATTTCAAGAGTCGCGTTGCAGCATATGCCAGCGCCTACCAAACTCTGGGTAAATACGAGGAGGACAATGACATG
CAGTACATCCAGATGATCGATGTGGGCCGAAAGCTGGTGCAGCATCGGCTTAGGGGCTTTCTCAGCGGCGGCATC
AGCACCTATCTGTCGAGTTTCAATCTTGCCCCGCGCCAGATTTGGATCACGCGTCATGGCCAGAGCATGGACAAT
GAGCTCGGCAAGCTGGGTGGCAATTCGCCAATTACTGAGCGCGGCCATTGCTATGGCTTGGCTCTGTATAAATTC
ATCACACAGCGGCGAAAGGAATGGCTCATGGAGCAAAAGAGTAAGATCGCCCAGGCCACGTTTCCGCCCCATCCG
GGCGACAACACGCCTCCGTATCCCGACATGAATCACGACCTGGAGCAGAAAAACTTTTGTGTTTGGACATCGATG
CTGCAGCGCAGCGTCGAGACGGCCGAGTATTTTGACGTCGACGATGACTATGACGTCAAAAACTGGGAGATGCTC
AATGAACTCAACGCTGGCCAATTCGAGGGCATGACGTACGAGGAGATTGCTCAAAAGTACCCCGACGAGTTTCGC
AAGCGGTCGCGCGACAAGCTCAATTACATATACCCTGGCGTCGGTGGCGAAGGTTACCTGCAAATCATCAGCCGC
CTCCGCGACATGGTGCGTGAGATTGAGCGCATCACAGACCATGTCCTCATTATAGGCCACCGCTCCGTCTGCCGC
GTTCTCATGGCCTATTTCATGGACCTGACGCGCGAAGACATTACCGACATGGATGTCCCTCTCGGCATGCTCTAT
TCCATTGAGCCCAAGCCATATGGCATTGCATTTCATGCTTACAAGTATGATGAGGCGCGAGGGTGGTTTGATGAA
TTACCCAATTACAAACCTCAGAAGGCGGGTGCAATTCATCCTCTATAG
Transcript >OphauG2|4122
ATGCCGGCCGCCGTCGTCATCCCCCAGCAAGTCGGGCAGAAACAAGCAAAGCAATCGTCGCTGGCAAAACTTGTC
ATGAACAACAATCTCGCTCTCTCATCGTCGCCTTCAGTCTCGCTCACGTCTCCCCAACCCGATGAAGCCCATCCT
CTTTCCGTCCAGCCGCCGCCACCCCGCAATGGAAATGCTGCCCACGACTCCCCGTCTGCGCCCACGGCACAGACT
GTGCGGATTCTGCACGACTTGACGGATACGCCATTGTCCCGGAGCGTCAACTCGACTGCCCCAAACTCGCCGCGC
ATGCCTCCACAGCGTCAAAATTCGGGCAGCCAGACGCCTCGAGTCCGCCCACATGCCACAACGCTCAATATTCCC
GGCATGACGCGCTCCCGAGTTTCTCCCGATGGTCGCATCCCGCAGCGCGATGTCGCTGCCAAGCTTGTCATTGTC
ATGGTTGGCCTTCCCGCTCGCGGCAAATCCTACATTACAAAGAAGCTGCAGCGCTACCTCTCCTGGCAGCAGCAC
GACTCACGTGTCTTCAACGTTGGCAACCGCCGCCGCAATGCCGTCGGTATCAAGGTGTCGCGCAAATCGAGGCTG
GCGCCTGAACCCCATCGCCTCGACCCTCCAGTTCAGGCCGCCACGATTCTGCTCAATGGCGTTCCCGGCCAGGAA
TGCACCGAGCCCCCGGAGCTGCACCTCGACGGCCCTTGCACCTCCAACTGCCAAGTCGTTGACCAGTCGGCCAAG
TTTTTCGATCCCACCAATGAGCAGGCTTCTGCCCTGAGAAATCAGGTTGCCATGCAGACGCTTGAAGAACTGCTC
GACTACCTGCTTGTTCAGGGCGGTGCCGTTGGCATCCTCGACGCCACAAACAGCACCATCAAGCGCCGGCAGCAA
ATTGTTGACCGTATCAAGGCTCGAGAGCCCAAGCTTGGCATTCTCTTCATTGAGAGCATCTGCCACGACGAGAAC
CTGCTCGAAGCCAATATGCGCCTCAAGCTCTCGGGTCCTGACTATCGCGACAAAGACCCCGCACAGTCTCTTGAC
GATTTCAAGAGTCGCGTTGCAGCATATGCCAGCGCCTACCAAACTCTGGGTAAATACGAGGAGGACAATGACATG
CAGTACATCCAGATGATCGATGTGGGCCGAAAGCTGGTGCAGCATCGGCTTAGGGGCTTTCTCAGCGGCGGCATC
AGCACCTATCTGTCGAGTTTCAATCTTGCCCCGCGCCAGATTTGGATCACGCGTCATGGCCAGAGCATGGACAAT
GAGCTCGGCAAGCTGGGTGGCAATTCGCCAATTACTGAGCGCGGCCATTGCTATGGCTTGGCTCTGTATAAATTC
ATCACACAGCGGCGAAAGGAATGGCTCATGGAGCAAAAGAGTAAGATCGCCCAGGCCACGTTTCCGCCCCATCCG
GGCGACAACACGCCTCCGTATCCCGACATGAATCACGACCTGGAGCAGAAAAACTTTTGTGTTTGGACATCGATG
CTGCAGCGCAGCGTCGAGACGGCCGAGTATTTTGACGTCGACGATGACTATGACGTCAAAAACTGGGAGATGCTC
AATGAACTCAACGCTGGCCAATTCGAGGGCATGACGTACGAGGAGATTGCTCAAAAGTACCCCGACGAGTTTCGC
AAGCGGTCGCGCGACAAGCTCAATTACATATACCCTGGCGTCGGTGGCGAAGGTTACCTGCAAATCATCAGCCGC
CTCCGCGACATGGTGCGTGAGATTGAGCGCATCACAGACCATGTCCTCATTATAGGCCACCGCTCCGTCTGCCGC
GTTCTCATGGCCTATTTCATGGACCTGACGCGCGAAGACATTACCGACATGGATGTCCCTCTCGGCATGCTCTAT
TCCATTGAGCCCAAGCCATATGGCATTGCATTTCATGCTTACAAGTATGATGAGGCGCGAGGGTGGTTTGATGAA
TTACCCAATTACAAACCTCAGAAGGCGGGTGCAATTCATCCTCTATAG
Gene >OphauG2|4122
ATGCCGGCCGCCGTCGTCATCCCCCAGCAAGGTGAGTGCGTGTGCCTGGACCAGCTTTCTTTCTTTCTGCCTTGG
CCCCGTAATCACGACGCTGCGCAGACATCCATTATCCCTATCCCTCCTTCATCCTTGAATTTAAGTCGCTGCATT
CCTCTCCCTCCTTCCCGCCCTGCCACCAAGTCCAAAAAAATTCCCCAGCGGGAGGGGCCAAAGTTTAAAAAAAAG
TCATTCGCCTCCACCATCCATCACTCACGCTTCTTCTTCCTCCGACCAGTCGGGCAGAAACAAGCAAAGCAATCG
TCGCTGGCAAAACTTGTCATGAACAACAATCTCGCTCTCTCATCGTCGCCTTCAGTCTCGCTCACGTCTCCCCAA
CCCGATGAAGCCCATCCTCTTTCCGTCCAGCCGCCGCCACCCCGCAATGGAAATGCTGCCCACGACTCCCCGTCT
GCGCCCACGGCACAGACTGTGCGGATTCTGCACGACTTGACGGATACGCCATTGTCCCGGAGCGTCAACTCGACT
GCCCCAAACTCGCCGCGCATGTACGTGTCCCTGTCCTTGTGTCCTTGTGTGTTTGCTAACGCCGCCAAGGCCTCC
ACAGCGTCAAAATTCGGGCAGCCAGACGCCTCGAGTCCGCCCACATGCCACAACGCTCAATATTCCCGGCATGAC
GCGCTCCCGAGTTTCTCCCGATGGTCGCATCCCGCAGCGCGATGTCGCTGCCAAGCTTGTCATTGTCATGGTTGG
CCTTCCCGCTCGCGGCAAATCCTACATTACAAAGAAGCTGCAGCGCTACCTCTCCTGGCAGCAGCACGACTCACG
TGTCTTCAACGTTGGCAACCGCCGCCGCAATGCCGTCGGTATCAAGGTGTCGCGCAAATCGAGGCTGGCGCCTGA
ACCCCATCGCCTCGACCCTCCAGTTCAGGCCGCCACGATTCTGCTCAATGGCGTTCCCGGCCAGGAATGCACCGA
GCCCCCGGAGCTGCACCTCGACGGCCCTTGCACCTCCAACTGCCAAGTCGTTGACCAGTCGGCCAAGTTTTTCGA
TCCCACCAATGAGCAGGCTTCTGCCCTGAGAAATCAGGTTGCCATGCAGACGCTTGAAGAACTGCTCGACTACCT
GCTTGTTCAGGGCGGTGCCGTTGGCATCCTCGACGCCACAAACAGCACCATCAAGCGCCGGCAGCAAATTGTTGA
CCGTATCAAGGCTCGAGAGCCCAAGCTTGGCATTCTCTTCATTGAGAGCATCTGCCACGACGAGAACCTGCTCGA
AGCCAATATGCGCCTCAAGCTCTCGGGTCCTGACTATCGCGACAAAGACCCCGCACAGTCTCTTGACGATTTCAA
GAGTCGCGTTGCAGCATATGCCAGCGCCTACCAAACTCTGGGTAAATACGAGGAGGACAATGACATGCAGTACAT
CCAGGTCCGCCCCGTCTCACTCTCCCCCGTCGCACCACTAAGTAAATGCCGTCCTAACTAGCCAACCCAGATGAT
CGATGTGGGCCGAAAGCTGGTGCAGCATCGGCTTAGGGGCTTTCTCAGCGGCGGCATCAGCACCTATCTGTCGAG
TTTCAATCTTGCCCCGCGCCAGATTTGGATCACGCGTCATGGCCAGAGCATGGACAATGAGCTCGGCAAGCTGGG
TGGCAATTCGCCAATTACTGAGCGCGGCCATTGCTATGGCTTGGCTCTGTATAAATTCATCACACAGCGGCGAAA
GGAATGGCTCATGGAGCAAAAGAGTAAGATCGCCCAGGCCACGTTTCCGCCCCATCCGGGCGACAACACGCCTCC
GTATCCCGACATGAATCACGACCTGGAGCAGAAAAACTTTTGTGTTTGGACATCGATGCTGCAGCGCAGCGTCGA
GACGGCCGAGTATTTTGACGTCGACGATGACTATGACGTCAAAAACTGGGAGATGCTCAATGAACTCAACGCTGG
CCAATTCGAGGGCATGACGTACGAGGAGATTGCTCAAAAGTACCCCGACGAGTTTCGCAAGCGGTCGCGCGACAA
GCTCAATTACATATACCCTGGCGTCGGTGGCGAAGGTTACCTGCAAATCATCAGCCGCCTCCGCGACATGGTGCG
TGAGATTGAGCGCATCACAGACCATGTCCTCATTATAGGCCACCGCTCCGTCTGCCGCGTTCTCATGGCCTATTT
CATGGACCTGACGCGCGAAGACATTACCGACATGGATGTCCCTCTCGGCATGCTCTATTCCATTGAGCCCAAGCC
ATATGGCATTGCATTTCATGCTTACAAGTATGATGAGGCGCGAGGGTGGTTTGATGAATTACCCAATTACAAACC
TCAGAAGGCGGGTGCAATTCATCCTCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail