Ophiocordyceps australis 1348a (Ghana)

General Properties

Protein ID	OphauG2\|4109
Gene name
Location	Contig_330:10079..11309
Strand	+
Gene length (bp)	1230
Transcript length (bp)	1065
Coding sequence length (bp)	1065
Protein length (aa)	355

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF00400	WD40	WD domain, G-beta repeat	1.5E-06	54	90
PF00400	WD40	WD domain, G-beta repeat	6.1E-03	101	133
PF00400	WD40	WD domain, G-beta repeat	3.2E-04	140	176
PF00400	WD40	WD domain, G-beta repeat	2.5E-02	190	217
PF00400	WD40	WD domain, G-beta repeat	1.7E-03	225	259
PF00400	WD40	WD domain, G-beta repeat	2.2E-04	269	309
PF12894	ANAPC4_WD40	Anaphase-promoting complex subunit 4 WD40 domain	2.1E-06	277	331

Swissprot hits

[Show all]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	39	354	6.0E-110
sp\|Q6PE01\|SNR40_MOUSE	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1	39	354	2.0E-109
sp\|Q96DI7\|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1	25	354	4.0E-109
sp\|O94620\|CWF17_SCHPO	Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1	6	353	8.0E-109
sp\|Q5RF51\|SNR40_PONAB	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1	25	354	3.0E-108

[Show all]

[Show less]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|Q2HJH6\|SNR40_BOVIN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1	39	354	6.0E-110
sp\|Q6PE01\|SNR40_MOUSE	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1	39	354	2.0E-109
sp\|Q96DI7\|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1	25	354	4.0E-109
sp\|O94620\|CWF17_SCHPO	Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1	6	353	8.0E-109
sp\|Q5RF51\|SNR40_PONAB	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1	25	354	3.0E-108
sp\|Q55AR8\|SNR40_DICDI	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1	36	354	2.0E-95
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	58	348	6.0E-36
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	55	350	4.0E-34
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	58	353	9.0E-34
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	35	345	5.0E-33
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	58	333	7.0E-33
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	56	343	1.0E-32
sp\|Q9D7H2\|WDR5B_MOUSE	WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1	56	343	3.0E-32
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	53	333	2.0E-31
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	58	353	3.0E-31
sp\|Q4V8C4\|WDR5B_RAT	WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1	56	343	5.0E-31
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	58	331	8.0E-31
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	58	348	1.0E-30
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	58	345	1.0E-30
sp\|Q5M786\|WDR5_XENTR	WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1	39	343	2.0E-30
sp\|Q2KIG2\|WDR5_BOVIN	WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1	56	343	3.0E-30
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	56	343	3.0E-30
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	56	343	3.0E-30
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	56	343	3.0E-30
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	58	350	4.0E-29
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	101	353	4.0E-29
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	43	338	7.0E-29
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	58	338	7.0E-29
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	58	338	8.0E-29
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	54	332	1.0E-28
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	101	353	1.0E-28
sp\|Q676U5\|A16L1_HUMAN	Autophagy-related protein 16-1 OS=Homo sapiens GN=ATG16L1 PE=1 SV=2	58	339	3.0E-28
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	55	345	3.0E-28
sp\|Q8C0J2\|A16L1_MOUSE	Autophagy-related protein 16-1 OS=Mus musculus GN=Atg16l1 PE=1 SV=1	58	333	4.0E-28
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	48	350	5.0E-28
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	54	350	7.0E-28
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	55	348	1.0E-27
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	60	350	1.0E-27
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	55	350	1.0E-27
sp\|Q93847\|YZLL_CAEEL	Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1	59	350	1.0E-27
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	41	348	1.0E-27
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	49	350	2.0E-27
sp\|Q9SY00\|WDR5B_ARATH	COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1	58	338	2.0E-27
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	37	339	4.0E-27
sp\|Q5XGI5\|WDR83_XENTR	WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1	52	343	4.0E-27
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	61	333	4.0E-27
sp\|Q5RAC9\|A16L1_PONAB	Autophagy-related protein 16-1 OS=Pongo abelii GN=ATG16L1 PE=2 SV=1	58	333	5.0E-27
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	54	332	8.0E-27
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	101	353	8.0E-27
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	101	353	2.0E-26
sp\|O15736\|TIPD_DICDI	Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1	16	352	2.0E-26
sp\|Q5I0B9\|ATG16_XENTR	Autophagy-related protein 16 OS=Xenopus tropicalis GN=atg16 PE=2 SV=2	55	349	3.0E-26
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	63	333	4.0E-26
sp\|Q6NNP0\|ATG16_ARATH	Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1	58	347	5.0E-26
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	101	353	6.0E-26
sp\|Q23256\|WDR53_CAEEL	WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1	2	326	6.0E-26
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	58	348	8.0E-26
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	55	339	9.0E-26
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	55	350	1.0E-25
sp\|Q5BK30\|DAW1_RAT	Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1	58	345	1.0E-25
sp\|Q17963\|WDR51_CAEEL	WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1	55	338	1.0E-25
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	101	353	2.0E-25
sp\|Q4V7Z1\|POC1B_XENLA	POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1	101	350	2.0E-25
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	34	345	2.0E-25
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	55	308	2.0E-25
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	34	345	2.0E-25
sp\|A8X8C6\|TG125_CAEBR	WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1	25	338	2.0E-25
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	58	308	4.0E-25
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	55	319	5.0E-25
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	101	353	5.0E-25
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	101	353	5.0E-25
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	101	353	7.0E-25
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	42	354	9.0E-25
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	57	332	1.0E-24
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	42	354	1.0E-24
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	42	354	1.0E-24
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	54	350	2.0E-24
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	101	353	2.0E-24
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	57	332	2.0E-24
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	57	332	2.0E-24
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	101	353	3.0E-24
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	38	333	5.0E-24
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	44	346	9.0E-24
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	54	350	1.0E-23
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	51	311	1.0E-23
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	101	353	1.0E-23
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	58	310	2.0E-23
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	44	346	2.0E-23
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	100	353	2.0E-23
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	34	345	2.0E-23
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	108	333	3.0E-23
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	55	304	3.0E-23
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	106	354	4.0E-23
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	108	337	5.0E-23
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	58	283	6.0E-23
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	100	348	7.0E-23
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	142	350	1.0E-22
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	97	354	1.0E-22
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	108	333	1.0E-22
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	58	308	1.0E-22
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	55	300	1.0E-22
sp\|Q3KQ62\|WDR83_XENLA	WD repeat domain-containing protein 83 OS=Xenopus laevis GN=wdr83 PE=2 SV=1	57	343	1.0E-22
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	139	354	2.0E-22
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	44	350	2.0E-22
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	32	333	2.0E-22
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	58	339	3.0E-22
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	2	354	3.0E-22
sp\|Q8YTC2\|Y2800_NOSS1	Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1	61	288	5.0E-22
sp\|Q9SY00\|WDR5B_ARATH	COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1	101	354	5.0E-22
sp\|Q3Y8L7\|DAW1_CHLRE	Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1	58	350	5.0E-22
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	58	339	5.0E-22
sp\|Q5BK30\|DAW1_RAT	Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1	44	347	6.0E-22
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	58	339	6.0E-22
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	58	308	7.0E-22
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	58	308	7.0E-22
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	58	308	7.0E-22
sp\|Q6DH44\|WDR83_DANRE	WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1	61	351	7.0E-22
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	61	345	9.0E-22
sp\|Q20636\|GBB2_CAEEL	Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2	57	258	9.0E-22
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	58	323	1.0E-21
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	44	346	1.0E-21
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	44	350	1.0E-21
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	139	354	1.0E-21
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	61	326	1.0E-21
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	61	326	1.0E-21
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	139	354	1.0E-21
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	58	335	1.0E-21
sp\|C3XVT5\|LIS1_BRAFL	Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1	58	354	1.0E-21
sp\|Q8N136\|DAW1_HUMAN	Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1	60	308	2.0E-21
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	101	353	2.0E-21
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	58	335	2.0E-21
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	64	345	3.0E-21
sp\|Q39190\|PRL2_ARATH	Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2	20	253	3.0E-21
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	23	339	3.0E-21
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	58	258	4.0E-21
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	60	308	4.0E-21
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	119	333	4.0E-21
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	119	333	4.0E-21
sp\|Q93847\|YZLL_CAEEL	Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1	21	354	7.0E-21
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	107	335	7.0E-21
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	57	311	8.0E-21
sp\|Q9VZF4\|FBXW7_DROME	F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1	47	354	8.0E-21
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	58	316	8.0E-21
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	58	316	8.0E-21
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	58	316	8.0E-21
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	58	316	8.0E-21
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	58	316	8.0E-21
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	58	316	8.0E-21
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	58	316	8.0E-21
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	58	345	9.0E-21
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	119	333	1.0E-20
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	76	324	1.0E-20
sp\|P38011\|GBLP_YEAST	Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4	99	335	1.0E-20
sp\|Q8YRI1\|YY46_NOSS1	Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1	98	349	2.0E-20
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	60	334	2.0E-20
sp\|F6ZT52\|POC1B_XENTR	POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1	46	314	2.0E-20
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	52	318	2.0E-20
sp\|Q8I0F4\|LIS1_DICDI	Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1	58	308	2.0E-20
sp\|B6Q4Z5\|SCONB_TALMQ	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1	2	354	2.0E-20
sp\|Q99973\|TEP1_HUMAN	Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2	57	326	2.0E-20
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	40	259	2.0E-20
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	58	308	2.0E-20
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	101	354	2.0E-20
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	139	354	2.0E-20
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	58	308	2.0E-20
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	58	308	2.0E-20
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	40	259	2.0E-20
sp\|Q9BRX9\|WDR83_HUMAN	WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1	43	342	3.0E-20
sp\|P52287\|GBB3_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1	40	259	3.0E-20
sp\|Q8YV57\|Y2124_NOSS1	Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1	65	314	4.0E-20
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	58	347	4.0E-20
sp\|Q9DAW6\|PRP4_MOUSE	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1	23	311	4.0E-20
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	139	354	4.0E-20
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	132	348	4.0E-20
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	58	335	4.0E-20
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	104	333	5.0E-20
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	58	310	5.0E-20
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	139	354	5.0E-20
sp\|Q4V7Z1\|POC1B_XENLA	POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1	46	318	6.0E-20
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	75	348	6.0E-20
sp\|Q93134\|GBLP_BIOGL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1	58	316	7.0E-20
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	44	349	7.0E-20
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	61	344	7.0E-20
sp\|Q5NVD0\|PRP4_PONAB	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1	23	311	7.0E-20
sp\|P79147\|GBB3_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1	40	259	7.0E-20
sp\|B8M7Q5\|SCONB_TALSN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1	42	275	8.0E-20
sp\|Q3MHE2\|PRP4_BOVIN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1	23	311	8.0E-20
sp\|Q5BLX8\|WDR83_RAT	WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1	46	342	8.0E-20
sp\|O43172\|PRP4_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2	23	311	8.0E-20
sp\|Q9SY00\|WDR5B_ARATH	COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1	58	258	9.0E-20
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	101	354	9.0E-20
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	60	308	1.0E-19
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	100	349	1.0E-19
sp\|Q5RDY7\|GBB5_PONAB	Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1	44	258	1.0E-19
sp\|B8P4B0\|LIS11_POSPM	Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1	58	308	1.0E-19
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	58	284	1.0E-19
sp\|Q80ZD0\|GBB5_TAMST	Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1	44	258	1.0E-19
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	58	308	1.0E-19
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	101	353	1.0E-19
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	58	308	1.0E-19
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	20	289	1.0E-19
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	100	344	1.0E-19
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	58	260	2.0E-19
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	58	319	2.0E-19
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	58	319	2.0E-19
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	58	319	2.0E-19
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	101	328	2.0E-19
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	58	308	2.0E-19
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	52	332	2.0E-19
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	58	307	2.0E-19
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	76	354	2.0E-19
sp\|O14435\|GBB_CRYPA	Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1	57	258	2.0E-19
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	58	348	2.0E-19
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	58	308	2.0E-19
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	58	308	2.0E-19
sp\|P62882\|GBB5_RAT	Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1	44	258	2.0E-19
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	101	353	2.0E-19
sp\|Q9DAJ4\|WDR83_MOUSE	WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1	46	342	2.0E-19
sp\|O14775\|GBB5_HUMAN	Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2	44	258	2.0E-19
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	61	344	2.0E-19
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	101	354	2.0E-19
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	58	310	3.0E-19
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	58	284	3.0E-19
sp\|Q6PNB6\|GBB5_RABIT	Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1	44	258	3.0E-19
sp\|Q21215\|GBLP_CAEEL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3	99	335	3.0E-19
sp\|P62881\|GBB5_MOUSE	Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1	44	258	3.0E-19
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	58	350	4.0E-19
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	43	350	4.0E-19
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	58	308	4.0E-19
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	70	324	4.0E-19
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	58	319	4.0E-19
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	58	308	5.0E-19
sp\|Q9VZF4\|FBXW7_DROME	F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1	58	319	6.0E-19
sp\|P83774\|GBLP_CANAL	Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2	58	351	6.0E-19
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	96	354	6.0E-19
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	58	350	7.0E-19
sp\|D3TLL6\|LIS1_GLOMM	Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1	28	354	7.0E-19
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	96	354	7.0E-19
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	58	322	7.0E-19
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	58	322	7.0E-19
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	58	310	8.0E-19
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	58	310	8.0E-19
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	127	354	8.0E-19
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	58	350	9.0E-19
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	58	309	9.0E-19
sp\|Q54LT8\|STRAP_DICDI	Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1	51	333	9.0E-19
sp\|P36408\|GBB_DICDI	Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1	57	258	9.0E-19
sp\|A8X8C6\|TG125_CAEBR	WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1	58	258	1.0E-18
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	58	308	1.0E-18
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	58	308	1.0E-18
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	74	354	1.0E-18
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	70	324	1.0E-18
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	4	275	1.0E-18
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	58	350	1.0E-18
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	58	261	1.0E-18
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	40	259	1.0E-18
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	40	259	1.0E-18
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	58	258	2.0E-18
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	58	258	2.0E-18
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	58	346	2.0E-18
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	58	354	2.0E-18
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	96	354	2.0E-18
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	58	308	2.0E-18
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	58	308	2.0E-18
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	58	308	2.0E-18
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	58	308	2.0E-18
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	58	308	2.0E-18
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	58	308	2.0E-18
sp\|Q4WT34\|PRP46_ASPFU	Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1	1	313	2.0E-18
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	101	353	2.0E-18
sp\|Q2UGU1\|LIS1_ASPOR	Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2	101	353	2.0E-18
sp\|B8N9H4\|LIS1_ASPFN	Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2	101	353	2.0E-18
sp\|P97499\|TEP1_MOUSE	Telomerase protein component 1 OS=Mus musculus GN=Tep1 PE=1 SV=1	44	321	2.0E-18
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	58	354	2.0E-18
sp\|C4JZS6\|LIS11_UNCRE	Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1	53	346	2.0E-18
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	58	308	2.0E-18
sp\|Q8L3Z8\|FZR2_ARATH	Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1	74	262	2.0E-18
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	76	324	2.0E-18
sp\|Q8LPL5\|FZR3_ARATH	Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1	74	262	2.0E-18
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	58	307	2.0E-18
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	39	334	3.0E-18
sp\|P38011\|GBLP_YEAST	Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4	58	308	3.0E-18
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	96	354	3.0E-18
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	58	354	3.0E-18
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	119	333	3.0E-18
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	96	354	3.0E-18
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	58	307	3.0E-18
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	58	308	3.0E-18
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	58	308	3.0E-18
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	58	308	3.0E-18
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	58	308	3.0E-18
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	58	308	3.0E-18
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	58	308	3.0E-18
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	58	308	3.0E-18
sp\|Q00659\|SCONB_EMENI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2	89	275	3.0E-18
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	52	322	3.0E-18
sp\|Q5GIS3\|GBB_PINFU	Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1	40	259	3.0E-18
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	58	260	3.0E-18
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	58	308	4.0E-18
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	58	308	4.0E-18
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	58	354	4.0E-18
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	58	354	4.0E-18
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	58	308	4.0E-18
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	58	307	4.0E-18
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	58	347	4.0E-18
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	58	347	4.0E-18
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	58	313	4.0E-18
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	58	308	4.0E-18
sp\|A8NEG8\|LIS1_COPC7	Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3	52	326	5.0E-18
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	58	261	5.0E-18
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	96	354	5.0E-18
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	58	307	5.0E-18
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	58	307	5.0E-18
sp\|Q9R1K5\|FZR_MOUSE	Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1	58	260	5.0E-18
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	58	308	5.0E-18
sp\|O08653\|TEP1_RAT	Telomerase protein component 1 OS=Rattus norvegicus GN=Tep1 PE=1 SV=1	57	321	5.0E-18
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	58	310	6.0E-18
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	101	354	6.0E-18
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	101	354	6.0E-18
sp\|B8PD53\|LIS12_POSPM	Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1	58	260	6.0E-18
sp\|Q9BVA0\|KTNB1_HUMAN	Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1	30	253	7.0E-18
sp\|Q8BG40\|KTNB1_MOUSE	Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1	30	253	7.0E-18
sp\|Q7ZUV2\|KTNB1_DANRE	Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1	55	290	7.0E-18
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	101	354	7.0E-18
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	101	354	7.0E-18
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	101	354	7.0E-18
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	108	326	7.0E-18
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	101	354	8.0E-18
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	76	324	8.0E-18
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	58	308	8.0E-18
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	58	308	8.0E-18
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	58	313	8.0E-18
sp\|Q9UM11\|FZR_HUMAN	Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2	58	260	8.0E-18
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	76	324	9.0E-18
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	60	318	1.0E-17
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	60	318	1.0E-17
sp\|Q93847\|YZLL_CAEEL	Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1	55	256	1.0E-17
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	96	354	1.0E-17
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	76	324	1.0E-17
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	58	354	1.0E-17
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	76	324	1.0E-17
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	96	354	1.0E-17
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	96	354	1.0E-17
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	74	354	1.0E-17
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	40	259	1.0E-17
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	58	319	1.0E-17
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	58	308	1.0E-17
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	101	354	1.0E-17
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	74	354	1.0E-17
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	58	333	1.0E-17
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	58	260	1.0E-17
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	96	354	1.0E-17
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	58	308	1.0E-17
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	58	319	1.0E-17
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	58	307	2.0E-17
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	96	354	2.0E-17
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	96	354	2.0E-17
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	96	354	2.0E-17
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	96	354	2.0E-17
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	96	354	2.0E-17
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	58	354	2.0E-17
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	96	354	2.0E-17
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	54	332	2.0E-17
sp\|Q61FW2\|SEL10_CAEBR	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1	58	331	2.0E-17
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	40	259	2.0E-17
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	43	319	2.0E-17
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	58	313	2.0E-17
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	59	353	2.0E-17
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	58	313	2.0E-17
sp\|Q9C270\|PWP2_NEUCR	Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1	58	346	2.0E-17
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	96	354	3.0E-17
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	58	307	3.0E-17
sp\|Q2UGU1\|LIS1_ASPOR	Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2	25	241	3.0E-17
sp\|B8N9H4\|LIS1_ASPFN	Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2	25	241	3.0E-17
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	96	354	3.0E-17
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	56	308	3.0E-17
sp\|O43071\|PRP17_SCHPO	Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1	52	343	3.0E-17
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	58	313	3.0E-17
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	55	348	3.0E-17
sp\|P74598\|Y1491_SYNY3	Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1	24	353	3.0E-17
sp\|P53699\|CDC4_CANAX	Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1	51	330	3.0E-17
sp\|Q54KL5\|WDR5_DICDI	WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1	55	258	4.0E-17
sp\|Q5JTN6\|WDR38_HUMAN	WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1	61	347	4.0E-17
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	58	308	4.0E-17
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	58	354	4.0E-17
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	58	310	4.0E-17
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	58	354	4.0E-17
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	58	354	4.0E-17
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	58	354	4.0E-17
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	58	354	4.0E-17
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	96	354	4.0E-17
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	58	354	4.0E-17
sp\|Q61FW2\|SEL10_CAEBR	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1	58	319	4.0E-17
sp\|O14727\|APAF_HUMAN	Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2	61	344	4.0E-17
sp\|O22212\|PRP4L_ARATH	U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1	31	310	4.0E-17
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	113	326	4.0E-17
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	89	260	4.0E-17
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	99	335	4.0E-17
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	96	354	5.0E-17
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	96	354	5.0E-17
sp\|Q8NAA4\|A16L2_HUMAN	Autophagy-related protein 16-2 OS=Homo sapiens GN=ATG16L2 PE=1 SV=2	58	327	5.0E-17
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	89	260	5.0E-17
sp\|Q922B6\|TRAF7_MOUSE	E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1	60	310	5.0E-17
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	58	354	6.0E-17
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	58	307	6.0E-17
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	58	354	6.0E-17
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	63	275	6.0E-17
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	40	259	6.0E-17
sp\|P43254\|COP1_ARATH	E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2	4	311	6.0E-17
sp\|P74442\|Y143_SYNY3	Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1	17	347	7.0E-17
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	59	353	7.0E-17
sp\|Q6Q0C0\|TRAF7_HUMAN	E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1	60	310	7.0E-17
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	64	354	7.0E-17
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	74	354	7.0E-17
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	96	354	8.0E-17
sp\|P23232\|GBB_LOLFO	Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1	40	259	8.0E-17
sp\|Q8VZS9\|FZR1_ARATH	Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1	83	284	8.0E-17
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	58	350	8.0E-17
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	58	354	9.0E-17
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	59	350	9.0E-17
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	132	348	9.0E-17
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	55	311	1.0E-16
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	58	350	1.0E-16
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	96	354	1.0E-16
sp\|P25635\|PWP2_YEAST	Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PWP2 PE=1 SV=2	14	328	1.0E-16
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	58	354	1.0E-16
sp\|A1C7E4\|SCONB_ASPCL	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1	52	328	1.0E-16
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	132	348	1.0E-16
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	55	258	1.0E-16
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	40	259	1.0E-16
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	40	259	1.0E-16
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	40	259	1.0E-16
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	40	259	1.0E-16
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	58	354	1.0E-16
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	132	348	1.0E-16
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	57	308	1.0E-16
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	57	308	1.0E-16
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	40	259	1.0E-16
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	89	260	1.0E-16
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	119	333	1.0E-16
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	139	354	1.0E-16
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	58	260	1.0E-16
sp\|A2QP30\|LIS1_ASPNC	Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1	58	333	1.0E-16
sp\|C5FWH1\|LIS1_ARTOC	Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1	101	353	1.0E-16
sp\|Q23256\|WDR53_CAEEL	WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1	58	258	2.0E-16
sp\|Q17963\|WDR51_CAEEL	WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1	58	258	2.0E-16
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	65	312	2.0E-16
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	103	332	2.0E-16
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	126	332	2.0E-16
sp\|Q2UFN8\|SCONB_ASPOR	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1	89	275	2.0E-16
sp\|B8NGT5\|SCONB_ASPFN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1	89	275	2.0E-16
sp\|A0DB19\|LIS11_PARTE	Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1	145	333	2.0E-16
sp\|Q5XGE2\|UTP15_XENTR	U3 small nucleolar RNA-associated protein 15 homolog OS=Xenopus tropicalis GN=utp15 PE=2 SV=1	52	341	2.0E-16
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	65	353	2.0E-16
sp\|D1ZEM6\|LIS12_SORMK	Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1	54	344	2.0E-16
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	100	353	2.0E-16
sp\|Q9C1X1\|PWP2_SCHPO	Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1	132	326	2.0E-16
sp\|Q5F3D7\|UTP15_CHICK	U3 small nucleolar RNA-associated protein 15 homolog OS=Gallus gallus GN=UTP15 PE=2 SV=1	52	341	2.0E-16
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	65	353	2.0E-16
sp\|Q42384\|PRL1_ARATH	Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1	58	311	2.0E-16
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	58	354	3.0E-16
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	33	242	3.0E-16
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	58	354	3.0E-16
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	58	350	3.0E-16
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	101	275	3.0E-16
sp\|P07834\|CDC4_YEAST	Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2	58	346	3.0E-16
sp\|B6QC06\|LIS12_TALMQ	Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1	53	333	3.0E-16
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	52	319	3.0E-16
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	58	353	3.0E-16
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	58	353	3.0E-16
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	77	348	3.0E-16
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	55	332	4.0E-16
sp\|Q42384\|PRL1_ARATH	Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1	75	261	4.0E-16
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	65	353	4.0E-16
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	40	259	4.0E-16
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	58	265	5.0E-16
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	50	346	5.0E-16
sp\|Q6P2Y2\|DAW1_XENTR	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1	56	258	5.0E-16
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	96	354	5.0E-16
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	145	333	5.0E-16
sp\|P93471\|COP1_PEA	E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1	4	316	5.0E-16
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	40	259	5.0E-16
sp\|B2B766\|LIS12_PODAN	Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1	22	334	5.0E-16
sp\|Q9UUG8\|TUP12_SCHPO	Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2	189	354	6.0E-16
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	33	253	6.0E-16
sp\|Q922B6\|TRAF7_MOUSE	E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1	99	348	6.0E-16
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	101	353	6.0E-16
sp\|D1ZEB4\|LIS11_SORMK	Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1	54	333	6.0E-16
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	74	354	6.0E-16
sp\|Q0P593\|DAW1_BOVIN	Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1	55	258	7.0E-16
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	141	333	7.0E-16
sp\|Q5FWQ6\|DAW1_XENLA	Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1	56	258	7.0E-16
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	101	353	7.0E-16
sp\|Q00664\|LIS1_EMENI	Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1	58	333	7.0E-16
sp\|B8P4B0\|LIS11_POSPM	Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1	58	353	8.0E-16
sp\|Q6Q0C0\|TRAF7_HUMAN	E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1	99	348	8.0E-16
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	69	310	8.0E-16
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	100	302	8.0E-16
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	40	259	8.0E-16
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	57	259	8.0E-16
sp\|Q5BK30\|DAW1_RAT	Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1	55	258	9.0E-16
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	42	261	9.0E-16
sp\|B2B766\|LIS12_PODAN	Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1	101	353	9.0E-16
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	141	333	1.0E-15
sp\|Q1LV15\|DAW1_DANRE	Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2	55	258	1.0E-15
sp\|Q6DH44\|WDR83_DANRE	WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1	88	353	1.0E-15
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	54	208	1.0E-15
sp\|B8M0Q1\|LIS1_TALSN	Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1	58	353	1.0E-15
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	51	350	1.0E-15
sp\|Q8WWQ0\|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2	60	353	1.0E-15
sp\|Q7RY30\|LIS11_NEUCR	Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2	54	333	1.0E-15
sp\|D4DG66\|LIS1_TRIVH	Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1	101	353	1.0E-15
sp\|D4AZ50\|LIS1_ARTBC	Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1	101	353	1.0E-15
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	52	328	1.0E-15
sp\|Q8VDD9\|PHIP_MOUSE	PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2	60	353	1.0E-15
sp\|Q9UT85\|YIPC_SCHPO	Uncharacterized WD repeat-containing protein C343.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC343.04c PE=3 SV=1	61	349	1.0E-15
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	60	350	1.0E-15
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	74	354	1.0E-15
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	58	260	1.0E-15
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	146	353	2.0E-15
sp\|Q20636\|GBB2_CAEEL	Guanine nucleotide-binding protein subunit beta-2 OS=Caenorhabditis elegans GN=gpb-2 PE=1 SV=2	58	333	2.0E-15
sp\|B8PD53\|LIS12_POSPM	Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1	58	333	2.0E-15
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	40	259	2.0E-15
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	40	259	2.0E-15
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	40	259	2.0E-15
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	40	259	2.0E-15
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	40	259	2.0E-15
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	132	348	2.0E-15
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	74	354	2.0E-15
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	58	260	2.0E-15
sp\|B6HP56\|LIS11_PENRW	Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1	101	353	2.0E-15
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	65	307	2.0E-15
sp\|A4R3M4\|LIS1_MAGO7	Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3	76	260	2.0E-15
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	24	258	3.0E-15
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	54	208	3.0E-15
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	54	179	3.0E-15
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	55	323	3.0E-15
sp\|A1DP19\|LIS1_NEOFI	Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1	58	353	3.0E-15
sp\|A7EKM8\|LIS1_SCLS1	Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1	101	353	3.0E-15
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	52	354	3.0E-15
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	61	334	3.0E-15
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	144	350	4.0E-15
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	58	353	4.0E-15
sp\|A0DB19\|LIS11_PARTE	Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1	56	309	4.0E-15
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	146	345	4.0E-15
sp\|Q5SUS0\|FBW10_MOUSE	F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1	101	316	4.0E-15
sp\|Q2GT28\|LIS12_CHAGB	Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1	101	353	4.0E-15
sp\|P49178\|GBB_MAIZE	Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1	58	348	4.0E-15
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	101	353	4.0E-15
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	146	345	4.0E-15
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	132	348	4.0E-15
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	132	348	4.0E-15
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	54	353	4.0E-15
sp\|Q5A7Q3\|PRP46_CANAL	Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1	41	258	4.0E-15
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	57	349	4.0E-15
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	144	350	5.0E-15
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	226	354	5.0E-15
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	104	333	5.0E-15
sp\|P46800\|GBLP_DICDI	Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2	144	353	5.0E-15
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	58	333	5.0E-15
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	132	348	5.0E-15
sp\|Q4R8E7\|DAW1_MACFA	Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1	55	258	6.0E-15
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	65	308	6.0E-15
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	58	260	6.0E-15
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	58	261	6.0E-15
sp\|Q7ZXZ2\|UTP15_XENLA	U3 small nucleolar RNA-associated protein 15 homolog OS=Xenopus laevis GN=utp15 PE=2 SV=1	52	341	6.0E-15
sp\|Q7S7L4\|LIS12_NEUCR	Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2	54	342	6.0E-15
sp\|B4JWA1\|LIS1_DROGR	Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1	32	354	7.0E-15
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	54	331	7.0E-15
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	58	260	7.0E-15
sp\|Q5ZMA2\|PRP19_CHICK	Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1	65	307	7.0E-15
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	57	349	7.0E-15
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	65	307	7.0E-15
sp\|Q9DC48\|PRP17_MOUSE	Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=2 SV=1	52	345	7.0E-15
sp\|Q00659\|SCONB_EMENI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2	52	346	8.0E-15
sp\|B6QC56\|LIS11_TALMQ	Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1	58	353	8.0E-15
sp\|O95170\|CDRT1_HUMAN	CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3	101	316	8.0E-15
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	54	354	8.0E-15
sp\|Q5XX13\|FBW10_HUMAN	F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2	101	316	8.0E-15
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	56	309	9.0E-15
sp\|O13286\|SRW1_SCHPO	WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1	58	260	9.0E-15
sp\|D3ZW91\|POC1B_RAT	POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1	39	258	1.0E-14
sp\|Q7T0P4\|POC1A_XENLA	POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2	24	258	1.0E-14
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	189	354	1.0E-14
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	189	354	1.0E-14
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	38	309	1.0E-14
sp\|Q9VPR4\|NLE_DROME	Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2	58	350	1.0E-14
sp\|Q0CY32\|SCONB_ASPTN	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1	55	328	1.0E-14
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	100	354	1.0E-14
sp\|Q291L9\|LIS1_DROPS	Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1	32	354	1.0E-14
sp\|B4GAJ1\|LIS1_DROPE	Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1	32	354	1.0E-14
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	65	308	1.0E-14
sp\|Q93794\|SEL10_CAEEL	F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3	145	348	1.0E-14
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	57	349	1.0E-14
sp\|Q8C7V3\|UTP15_MOUSE	U3 small nucleolar RNA-associated protein 15 homolog OS=Mus musculus GN=Utp15 PE=1 SV=1	52	348	1.0E-14
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	100	353	1.0E-14
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	132	348	1.0E-14
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	146	345	1.0E-14
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	104	354	1.0E-14
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	146	345	1.0E-14
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	57	349	1.0E-14
sp\|B4LQ21\|LIS1_DROVI	Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1	32	354	2.0E-14
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	104	354	2.0E-14
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	75	260	2.0E-14
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	104	354	2.0E-14
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	104	354	2.0E-14
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	104	354	2.0E-14
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	146	345	2.0E-14
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	104	354	2.0E-14
sp\|Q5ZMC3\|WSDU1_CHICK	WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2	55	333	2.0E-14
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	146	345	2.0E-14
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	146	345	2.0E-14
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	57	309	2.0E-14
sp\|P0CS36\|HAT2_CRYNJ	Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1	15	308	2.0E-14
sp\|P0CS37\|HAT2_CRYNB	Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1	15	308	2.0E-14
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	65	307	2.0E-14
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	65	307	2.0E-14
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	100	353	2.0E-14
sp\|Q6C709\|PRP46_YARLI	Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2	34	254	2.0E-14
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	75	260	2.0E-14
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	75	260	2.0E-14
sp\|O43017\|SWD3_SCHPO	Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1	58	274	2.0E-14
sp\|Q9NSI6\|BRWD1_HUMAN	Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4	60	350	2.0E-14
sp\|B4P6P9\|LIS1_DROYA	Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1	32	354	3.0E-14
sp\|B3NPW0\|LIS1_DROER	Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1	32	354	3.0E-14
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	100	354	3.0E-14
sp\|Q6CKE8\|PRP46_KLULA	Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1	58	313	3.0E-14
sp\|Q6DTM3\|AHI1_RAT	Jouberin OS=Rattus norvegicus GN=Ahi1 PE=1 SV=1	101	342	3.0E-14
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	104	354	3.0E-14
sp\|O60508\|PRP17_HUMAN	Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1	52	345	3.0E-14
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	146	345	3.0E-14
sp\|P47025\|MDV1_YEAST	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1	58	261	3.0E-14
sp\|Q4WLM7\|LIS1_ASPFU	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1	58	353	3.0E-14
sp\|B0XM00\|LIS1_ASPFC	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1	58	353	3.0E-14
sp\|Q8SRB0\|GBLP_ENCCU	Guanine nucleotide-binding protein subunit beta-like protein OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1110 PE=1 SV=1	101	315	3.0E-14
sp\|Q0CJD8\|MDV1_ASPTN	Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2	54	354	3.0E-14
sp\|Q9D7H2\|WDR5B_MOUSE	WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1	145	350	4.0E-14
sp\|Q8H0T9\|KTNB1_ARATH	Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3	55	349	4.0E-14
sp\|Q9BRX9\|WDR83_HUMAN	WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1	101	353	4.0E-14
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	52	345	4.0E-14
sp\|B4QHG6\|LIS1_DROSI	Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1	32	354	4.0E-14
sp\|B4HSL3\|LIS1_DROSE	Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1	32	354	4.0E-14
sp\|Q7KNS3\|LIS1_DROME	Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2	32	354	4.0E-14
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	104	354	4.0E-14
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	76	291	4.0E-14
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	99	335	4.0E-14
sp\|A2AHJ4\|BRWD3_MOUSE	Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1	60	353	4.0E-14
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	104	354	4.0E-14
sp\|O35353\|GBB4_RAT	Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4	40	259	4.0E-14
sp\|Q2UA71\|HAT2_ASPOR	Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1	33	260	4.0E-14
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	100	308	4.0E-14
sp\|A6ZQL5\|MDV1_YEAS7	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1	58	261	4.0E-14
sp\|Q5ZIU8\|KTNB1_CHICK	Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2	33	246	5.0E-14
sp\|Q01369\|GBLP_NEUCR	Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1	60	260	5.0E-14
sp\|B4KT48\|LIS1_DROMO	Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1	32	354	5.0E-14
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	98	351	5.0E-14
sp\|P87177\|YB1C_SCHPO	Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1	7	352	5.0E-14
sp\|A7MB12\|UTP15_BOVIN	U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1	52	350	5.0E-14
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	58	260	5.0E-14
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	52	345	6.0E-14
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	58	260	6.0E-14
sp\|Q6S7B0\|TAF5_ARATH	Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1	48	241	6.0E-14
sp\|Q5ZMA2\|PRP19_CHICK	Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1	58	220	6.0E-14
sp\|Q6KAU8\|A16L2_MOUSE	Autophagy-related protein 16-2 OS=Mus musculus GN=Atg16l2 PE=2 SV=2	58	327	6.0E-14
sp\|Q8TED0\|UTP15_HUMAN	U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens GN=UTP15 PE=1 SV=3	52	350	6.0E-14
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	58	216	6.0E-14
sp\|Q9VLN1\|WDR82_DROME	WD repeat-containing protein 82 OS=Drosophila melanogaster GN=Wdr82 PE=1 SV=1	61	348	6.0E-14
sp\|Q55563\|Y163_SYNY3	Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1	55	350	7.0E-14
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	23	258	7.0E-14
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	55	312	7.0E-14
sp\|Q2GT28\|LIS12_CHAGB	Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1	58	260	7.0E-14
sp\|P29387\|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4	40	259	7.0E-14
sp\|A2RRU3\|UTP15_RAT	U3 small nucleolar RNA-associated protein 15 homolog OS=Rattus norvegicus GN=Utp15 PE=2 SV=1	52	348	7.0E-14
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	57	309	7.0E-14
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	57	309	7.0E-14
sp\|C6HTE8\|LIS1_AJECH	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1	54	334	7.0E-14
sp\|C0NRC6\|LIS1_AJECG	Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1	54	334	7.0E-14
sp\|C5PFX0\|LIS1_COCP7	Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2	101	353	7.0E-14
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	55	312	8.0E-14
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	55	312	8.0E-14
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	145	353	8.0E-14
sp\|Q8K3E5\|AHI1_MOUSE	Jouberin OS=Mus musculus GN=Ahi1 PE=1 SV=2	101	342	8.0E-14
sp\|Q75LV5\|YAO_ORYSJ	U3 snoRNP-associated protein-like YAOH OS=Oryza sativa subsp. japonica GN=Os03g0625900 PE=2 SV=1	96	322	8.0E-14
sp\|C4Q0P6\|LIS1_SCHMA	Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1	55	261	9.0E-14
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	58	333	9.0E-14
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	108	354	9.0E-14
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	75	275	9.0E-14
sp\|O14170\|POP2_SCHPO	WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1	101	326	9.0E-14
sp\|P36408\|GBB_DICDI	Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1	65	328	1.0E-13
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	58	333	1.0E-13
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	58	333	1.0E-13
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	56	261	1.0E-13
sp\|Q9C1X1\|PWP2_SCHPO	Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1	55	323	1.0E-13
sp\|C1GB49\|LIS1_PARBD	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1	55	242	1.0E-13
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	61	345	1.0E-13
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	59	333	1.0E-13
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	56	260	1.0E-13
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	75	260	1.0E-13
sp\|Q0VC24\|WDR12_BOVIN	Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1	60	270	1.0E-13
sp\|P97865\|PEX7_MOUSE	Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1	75	308	1.0E-13
sp\|P29829\|GBB2_DROME	Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3	49	258	1.0E-13
sp\|P38123\|SWD3_YEAST	COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1	72	224	1.0E-13
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	55	310	1.0E-13
sp\|P49695\|PKWA_THECU	Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1	176	333	2.0E-13
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	98	350	2.0E-13
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	58	308	2.0E-13
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	60	263	2.0E-13
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	58	237	2.0E-13
sp\|A1DP19\|LIS1_NEOFI	Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1	55	241	2.0E-13
sp\|B6GZD3\|LIS12_PENRW	Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1	101	353	2.0E-13
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	104	354	2.0E-13
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	104	354	2.0E-13
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	55	242	2.0E-13
sp\|C0S902\|LIS1_PARBP	Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2	75	275	2.0E-13
sp\|O14170\|POP2_SCHPO	WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1	57	319	2.0E-13
sp\|A2R3Z3\|MDV1_ASPNC	Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2	101	354	2.0E-13
sp\|A5DL92\|YTM1_PICGU	Ribosome biogenesis protein YTM1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=YTM1 PE=3 SV=2	47	308	2.0E-13
sp\|Q4WEI5\|HAT2_ASPFU	Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1	33	308	2.0E-13
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	124	348	2.0E-13
sp\|A8PTE4\|MDV1_MALGO	Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1	101	354	2.0E-13
sp\|B4KTK4\|CIAO1_DROMO	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1	58	354	2.0E-13
sp\|Q6RI45\|BRWD3_HUMAN	Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2	60	353	2.0E-13
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	100	308	2.0E-13
sp\|Q8R537\|PEX7_CRIGR	Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1	75	308	2.0E-13
sp\|Q8BHD1\|POC1B_MOUSE	POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1	39	258	3.0E-13
sp\|O76734\|TUP1_DICDI	General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1	58	258	3.0E-13
sp\|Q4P9P9\|LIS1_USTMA	Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1	58	323	3.0E-13
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	55	261	3.0E-13
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	191	348	3.0E-13
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	98	350	3.0E-13
sp\|Q9C270\|PWP2_NEUCR	Periodic tryptophan protein 2 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B18D24.40 PE=3 SV=1	86	323	3.0E-13
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	60	263	3.0E-13
sp\|C5FWH1\|LIS1_ARTOC	Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1	76	271	3.0E-13
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	60	263	3.0E-13
sp\|A1CBP8\|MDV1_ASPCL	Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1	101	354	3.0E-13
sp\|P40968\|PRP17_YEAST	Pre-mRNA-processing factor 17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC40 PE=1 SV=2	52	323	3.0E-13
sp\|Q94BR4\|PR19A_ARATH	Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1	65	274	3.0E-13
sp\|Q9V3J8\|WDS_DROME	Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1	145	350	4.0E-13
sp\|Q17963\|WDR51_CAEEL	WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1	55	216	4.0E-13
sp\|Q8JZX3\|POC1A_MOUSE	POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2	50	258	4.0E-13
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	189	354	4.0E-13
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	50	313	4.0E-13
sp\|D3BUN1\|LIS1_POLPA	Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1	55	308	4.0E-13
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	54	220	4.0E-13
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	54	220	4.0E-13
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	108	354	4.0E-13
sp\|Q54PE0\|PWP2_DICDI	Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1	88	346	4.0E-13
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	100	353	4.0E-13
sp\|Q9Y6I7\|WSB1_HUMAN	WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1	55	310	4.0E-13
sp\|Q6FJZ9\|PRP46_CANGA	Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1	52	353	4.0E-13
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	55	310	4.0E-13
sp\|Q54KM3\|CDH1_DICDI	Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1	50	262	4.0E-13
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	142	347	5.0E-13
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	142	347	5.0E-13
sp\|P29829\|GBB2_DROME	Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3	65	308	5.0E-13
sp\|A2CEH0\|POC1B_DANRE	POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1	39	258	6.0E-13
sp\|A1CUD6\|LIS11_ASPCL	Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1	55	241	6.0E-13
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	52	353	6.0E-13
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	52	353	6.0E-13
sp\|O94423\|MFR1_SCHPO	Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1	55	267	6.0E-13
sp\|Q758R7\|MDV1_ASHGO	Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1	59	340	6.0E-13
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	59	332	6.0E-13
sp\|B4LJT7\|CIAO1_DROVI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1	58	354	6.0E-13
sp\|Q5AXW3\|MDV1_EMENI	Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2	101	354	6.0E-13
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	76	216	6.0E-13
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	101	335	7.0E-13
sp\|Q7S8R5\|MDV1_NEUCR	Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2	101	354	7.0E-13
sp\|Q4V8C4\|WDR5B_RAT	WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1	145	350	8.0E-13
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	54	220	8.0E-13
sp\|Q9UKB1\|FBW1B_HUMAN	F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1	160	354	8.0E-13
sp\|Q7RXH4\|EIF3I_NEUCR	Eukaryotic translation initiation factor 3 subunit I OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-34 PE=3 SV=1	100	350	8.0E-13
sp\|B4HRQ6\|CIAO1_DROSE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1	58	265	8.0E-13
sp\|Q640J6\|WD82A_XENLA	WD repeat-containing protein 82-A OS=Xenopus laevis GN=wdr82-a PE=2 SV=1	61	348	8.0E-13
sp\|G0SA60\|SEC13_CHATD	Protein transport protein SEC13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=SEC13 PE=3 SV=2	53	308	8.0E-13
sp\|Q8TC44\|POC1B_HUMAN	POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1	57	258	9.0E-13
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	54	220	9.0E-13
sp\|Q5BE22\|PRP46_EMENI	Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1	100	354	9.0E-13
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	98	350	9.0E-13
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	58	237	9.0E-13
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	58	220	9.0E-13
sp\|P53622\|COPA_YEAST	Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2	120	353	9.0E-13
sp\|Q12417\|PRP46_YEAST	Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1	120	345	9.0E-13
sp\|Q5M786\|WDR5_XENTR	WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1	145	350	1.0E-12
sp\|Q2KIG2\|WDR5_BOVIN	WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1	145	350	1.0E-12
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	145	350	1.0E-12
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	145	350	1.0E-12
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	145	350	1.0E-12
sp\|Q54LT8\|STRAP_DICDI	Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1	58	258	1.0E-12
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	100	308	1.0E-12
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	98	353	1.0E-12
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	98	350	1.0E-12
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	58	237	1.0E-12
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	5	241	1.0E-12
sp\|A4R3M4\|LIS1_MAGO7	Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3	54	354	1.0E-12
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	101	308	1.0E-12
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	58	220	1.0E-12
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	114	352	1.0E-12
sp\|Q4WLM7\|LIS1_ASPFU	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1	55	241	1.0E-12
sp\|B0XM00\|LIS1_ASPFC	Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1	55	241	1.0E-12
sp\|A1CF18\|LIS12_ASPCL	Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1	54	353	1.0E-12
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	61	260	1.0E-12
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	61	260	1.0E-12
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	100	353	1.0E-12
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	55	310	1.0E-12
sp\|Q8BFQ4\|WDR82_MOUSE	WD repeat-containing protein 82 OS=Mus musculus GN=Wdr82 PE=1 SV=1	61	348	1.0E-12
sp\|Q6UXN9\|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens GN=WDR82 PE=1 SV=1	61	348	1.0E-12
sp\|Q6GL39\|WDR82_XENTR	WD repeat-containing protein 82 OS=Xenopus tropicalis GN=wdr82 PE=2 SV=1	61	333	1.0E-12
sp\|Q58E77\|WD82B_XENLA	WD repeat-containing protein 82-B OS=Xenopus laevis GN=wdr82-b PE=2 SV=1	61	348	1.0E-12
sp\|A7THX0\|MDV1_VANPO	Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1	52	261	1.0E-12
sp\|Q54H44\|WDR83_DICDI	WD repeat domain-containing protein 83 homolog OS=Dictyostelium discoideum GN=morg1 PE=3 SV=1	58	343	1.0E-12
sp\|Q24371\|L2DTL_DROME	Protein lethal(2)denticleless OS=Drosophila melanogaster GN=l(2)dtl PE=1 SV=2	65	345	1.0E-12
sp\|P20053\|PRP4_YEAST	U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1	57	259	1.0E-12
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	146	354	1.0E-12
sp\|Q55AR8\|SNR40_DICDI	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1	55	262	2.0E-12
sp\|Q9M2Z2\|WDR5A_ARATH	COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1	146	353	2.0E-12
sp\|Q2TBP4\|POC1A_BOVIN	POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1	50	258	2.0E-12
sp\|Q229Z6\|POC1_TETTS	POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1	101	354	2.0E-12
sp\|P62882\|GBB5_RAT	Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1	41	333	2.0E-12
sp\|Q25189\|GBLP_HYDVU	Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1	57	260	2.0E-12
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	188	354	2.0E-12
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	58	328	2.0E-12
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	58	328	2.0E-12
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	58	328	2.0E-12
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	58	328	2.0E-12
sp\|O61585\|KTNB1_STRPU	Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1	55	290	2.0E-12
sp\|D5GBI7\|LIS1_TUBMM	Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1	55	241	2.0E-12
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	146	340	2.0E-12
sp\|Q86TI4\|WDR86_HUMAN	WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3	76	261	2.0E-12
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	58	220	2.0E-12
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	58	220	2.0E-12
sp\|P29829\|GBB2_DROME	Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3	58	333	2.0E-12
sp\|Q7ZW33\|UTP15_DANRE	U3 small nucleolar RNA-associated protein 15 homolog OS=Danio rerio GN=utp15 PE=2 SV=1	52	348	2.0E-12
sp\|P61480\|WDR12_RAT	Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1	60	270	2.0E-12
sp\|B4P7Q3\|CIAO1_DROYA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1	58	265	2.0E-12
sp\|Q8RXA7\|SCD1_ARATH	DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1	97	345	2.0E-12
sp\|Q7K1Y4\|CIAO1_DROME	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1	58	265	2.0E-12
sp\|Q2HBX6\|LIS11_CHAGB	Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1	58	333	2.0E-12
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	55	310	2.0E-12
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	55	354	2.0E-12
sp\|B4JW81\|CIAO1_DROGR	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1	58	354	2.0E-12
sp\|B4GDM7\|CIAO1_DROPE	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2	58	353	2.0E-12
sp\|Q9LJR3\|SPA3_ARATH	Protein SPA1-RELATED 3 OS=Arabidopsis thaliana GN=SPA3 PE=1 SV=1	57	308	2.0E-12
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	52	175	3.0E-12
sp\|Q8VEJ4\|NLE1_MOUSE	Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4	52	175	3.0E-12
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	52	175	3.0E-12
sp\|Q5RDY7\|GBB5_PONAB	Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1	41	333	3.0E-12
sp\|Q80ZD0\|GBB5_TAMST	Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1	41	333	3.0E-12
sp\|P62881\|GBB5_MOUSE	Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1	41	333	3.0E-12
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	19	219	3.0E-12
sp\|Q5SRY7\|FBW1B_MOUSE	F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1	163	354	3.0E-12
sp\|Q6L4F8\|GBLPB_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1	58	308	3.0E-12
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	70	260	3.0E-12
sp\|Q292E8\|CIAO1_DROPS	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1	58	353	3.0E-12
sp\|Q32PJ6\|CIAO1_BOVIN	Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1	70	354	3.0E-12
sp\|Q2GTM8\|EIF3I_CHAGB	Eukaryotic translation initiation factor 3 subunit I OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF34 PE=3 SV=1	100	350	3.0E-12
sp\|B4MY77\|CIAO1_DROWI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1	58	353	3.0E-12
sp\|Q40507\|GBB3_TOBAC	Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1	58	309	3.0E-12
sp\|Q15269\|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2	147	353	3.0E-12
sp\|P42527\|MHCKA_DICDI	Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2	101	328	3.0E-12
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	98	326	3.0E-12
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	129	345	3.0E-12
sp\|Q9JHB4\|WDR31_MOUSE	WD repeat-containing protein 31 OS=Mus musculus GN=Wdr31 PE=2 SV=1	55	259	3.0E-12
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	52	175	4.0E-12
sp\|O42249\|GBLP_ORENI	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1	60	260	4.0E-12
sp\|O14775\|GBB5_HUMAN	Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2	41	333	4.0E-12
sp\|Q6PNB6\|GBB5_RABIT	Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1	9	333	4.0E-12
sp\|P16649\|TUP1_YEAST	General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2	55	265	4.0E-12
sp\|G0SC29\|NLE1_CHATD	Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2	48	175	4.0E-12
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	146	340	4.0E-12
sp\|Q4ICM0\|LIS1_GIBZE	Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2	54	339	4.0E-12
sp\|B4QFZ8\|CIAO1_DROSI	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1	58	258	4.0E-12
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	129	345	4.0E-12
sp\|Q4I7L0\|HAT2_GIBZE	Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1	51	308	4.0E-12
sp\|Q5RFQ3\|PWP2_PONAB	Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1	147	347	4.0E-12
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	129	345	4.0E-12
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	129	345	4.0E-12
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	129	345	4.0E-12
sp\|Q9JJA4\|WDR12_MOUSE	Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1	60	270	4.0E-12
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	160	322	5.0E-12
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	54	220	5.0E-12
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	101	308	5.0E-12
sp\|P69104\|GBLP_TRYBR	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1	99	354	5.0E-12
sp\|P69103\|GBLP_TRYBB	Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1	99	354	5.0E-12
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	61	260	5.0E-12
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	75	261	5.0E-12
sp\|C7Z6H2\|LIS1_NECH7	Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1	54	354	5.0E-12
sp\|A7RWD2\|CIAO1_NEMVE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1	58	350	5.0E-12
sp\|O22785\|PR19B_ARATH	Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3	58	348	5.0E-12
sp\|Q7ZVA0\|SMU1_DANRE	WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1	103	333	5.0E-12
sp\|P93397\|GBB1_TOBAC	Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1	58	309	5.0E-12
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	39	219	6.0E-12
sp\|O14727\|APAF_HUMAN	Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2	52	345	6.0E-12
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	75	261	6.0E-12
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	75	261	6.0E-12
sp\|O00628\|PEX7_HUMAN	Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1	75	260	6.0E-12
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	75	261	6.0E-12
sp\|Q5REE0\|UTP15_PONAB	U3 small nucleolar RNA-associated protein 15 homolog OS=Pongo abelii GN=UTP15 PE=2 SV=1	66	350	6.0E-12
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	70	350	7.0E-12
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	141	346	7.0E-12
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	141	346	7.0E-12
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	141	346	7.0E-12
sp\|Q7ZVF0\|POC1A_DANRE	POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1	58	258	8.0E-12
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	52	244	8.0E-12
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	52	244	8.0E-12
sp\|Q39190\|PRL2_ARATH	Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2	161	345	8.0E-12
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	74	349	8.0E-12
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	108	350	8.0E-12
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	55	258	8.0E-12
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	141	346	8.0E-12
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	141	346	8.0E-12
sp\|Q5RD06\|POC1B_PONAB	POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1	57	258	9.0E-12
sp\|Q7SZM9\|TB1RA_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1	100	333	9.0E-12
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	58	308	9.0E-12
sp\|Q8NBT0\|POC1A_HUMAN	POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2	50	258	1.0E-11
sp\|Q10281\|GBLP_SCHPO	Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3	57	260	1.0E-11
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	19	175	1.0E-11
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	74	349	1.0E-11
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	98	354	1.0E-11
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	100	333	1.0E-11
sp\|Q9BZK7\|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1	100	333	1.0E-11
sp\|Q6GPC6\|TB1RB_XENLA	F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1	100	333	1.0E-11
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	188	353	1.0E-11
sp\|P56094\|TUP1_KLULA	General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2	52	240	1.0E-11
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	53	350	1.0E-11
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	60	260	1.0E-11
sp\|D4DG66\|LIS1_TRIVH	Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1	76	271	1.0E-11
sp\|D4AZ50\|LIS1_ARTBC	Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1	76	271	1.0E-11
sp\|A2QCU8\|SCONB_ASPNC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1	55	312	1.0E-11
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	75	327	1.0E-11
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	75	327	1.0E-11
sp\|Q6C709\|PRP46_YARLI	Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2	130	333	1.0E-11
sp\|C5JD40\|LIS1_AJEDS	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1	55	242	1.0E-11
sp\|C5GVJ9\|LIS1_AJEDR	Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1	55	242	1.0E-11
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	75	261	1.0E-11
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	40	308	1.0E-11
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	145	345	1.0E-11
sp\|Q54H44\|WDR83_DICDI	WD repeat domain-containing protein 83 homolog OS=Dictyostelium discoideum GN=morg1 PE=3 SV=1	100	352	1.0E-11
sp\|Q93134\|GBLP_BIOGL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1	60	260	2.0E-11
sp\|Q3MHE2\|PRP4_BOVIN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1	65	345	2.0E-11
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	98	354	2.0E-11
sp\|O14435\|GBB_CRYPA	Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1	5	328	2.0E-11
sp\|A9V790\|LIS1_MONBE	Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1	175	348	2.0E-11
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	163	354	2.0E-11
sp\|Q8BHJ5\|TBL1R_MOUSE	F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1	100	333	2.0E-11
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	55	261	2.0E-11
sp\|Q5GIS3\|GBB_PINFU	Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1	101	305	2.0E-11
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	139	354	2.0E-11
sp\|O18640\|GBLP_DROME	Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2	57	260	2.0E-11
sp\|B6HP56\|LIS11_PENRW	Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1	55	241	2.0E-11
sp\|Q0U1B1\|LIS1_PHANO	Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1	55	242	2.0E-11
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	55	220	2.0E-11
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	75	261	2.0E-11
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	75	261	2.0E-11
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	75	261	2.0E-11
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	145	340	2.0E-11
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	101	353	2.0E-11
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	58	333	2.0E-11
sp\|Q12417\|PRP46_YEAST	Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1	100	260	2.0E-11
sp\|Q6PBD6\|WDR61_XENTR	WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1	74	261	2.0E-11
sp\|Q6DH44\|WDR83_DANRE	WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1	6	311	3.0E-11
sp\|O42248\|GBLP_DANRE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1	60	260	3.0E-11
sp\|P38011\|GBLP_YEAST	Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4	60	260	3.0E-11
sp\|Q9DAW6\|PRP4_MOUSE	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1	65	345	3.0E-11
sp\|Q5NVD0\|PRP4_PONAB	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1	65	345	3.0E-11
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	54	220	3.0E-11
sp\|O60907\|TBL1X_HUMAN	F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3	100	333	3.0E-11
sp\|P83774\|GBLP_CANAL	Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2	60	260	3.0E-11
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	53	261	3.0E-11
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	101	308	3.0E-11
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	101	308	3.0E-11
sp\|Q9QXE7\|TBL1X_MOUSE	F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2	100	333	3.0E-11
sp\|P25387\|GBLP_CHLRE	Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1	50	260	3.0E-11
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	55	220	3.0E-11
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	52	175	3.0E-11
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	65	309	3.0E-11
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	65	309	3.0E-11
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	65	309	3.0E-11
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	65	309	3.0E-11
sp\|Q9VU65\|POC1_DROME	POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1	19	310	3.0E-11
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	75	261	3.0E-11
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	75	261	3.0E-11
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	56	258	3.0E-11
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	145	348	3.0E-11
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	60	260	4.0E-11
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	60	260	4.0E-11
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	60	260	4.0E-11
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	60	260	4.0E-11
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	60	260	4.0E-11
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	60	260	4.0E-11
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	60	260	4.0E-11
sp\|B5X3C4\|LIS1B_SALSA	Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1	55	261	4.0E-11
sp\|Q15542\|TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	100	308	4.0E-11
sp\|Q8C092\|TAF5_MOUSE	Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1	100	310	4.0E-11
sp\|Q4R8H1\|TBL1X_MACFA	F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1	54	220	4.0E-11
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	58	350	4.0E-11
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	101	305	4.0E-11
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	57	333	4.0E-11
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	57	333	4.0E-11
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	51	335	4.0E-11
sp\|Q9NYS7\|WSB2_HUMAN	WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1	119	333	4.0E-11
sp\|Q4R4I8\|COPB2_MACFA	Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1	57	315	4.0E-11
sp\|O55029\|COPB2_MOUSE	Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2	57	315	4.0E-11
sp\|P35605\|COPB2_BOVIN	Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3	57	315	4.0E-11
sp\|Q5R664\|COPB2_PONAB	Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1	57	315	4.0E-11
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	146	353	5.0E-11
sp\|O43172\|PRP4_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2	65	345	5.0E-11
sp\|P0CS49\|PRP46_CRYNB	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1	52	216	5.0E-11
sp\|P0CS48\|PRP46_CRYNJ	Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1	52	216	5.0E-11
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	57	316	5.0E-11
sp\|Q54PE0\|PWP2_DICDI	Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1	55	259	5.0E-11
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	206	350	5.0E-11
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	50	258	5.0E-11
sp\|P35606\|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2	57	315	5.0E-11
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	223	354	6.0E-11
sp\|Q95RJ9\|EBI_DROME	F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2	51	220	6.0E-11
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	54	218	7.0E-11
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	101	305	7.0E-11
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	60	260	7.0E-11
sp\|A0AUS0\|WSDU1_DANRE	WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1	54	313	7.0E-11
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	65	309	7.0E-11
sp\|Q3ULA2\|FBW1A_MOUSE	F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2	58	260	7.0E-11
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	101	305	8.0E-11
sp\|Q5A7Q3\|PRP46_CANAL	Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1	100	261	8.0E-11
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	144	354	8.0E-11
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	57	333	8.0E-11
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	57	333	8.0E-11
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	143	353	9.0E-11
sp\|O13282\|TAF5_SCHPO	Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1	42	351	9.0E-11
sp\|Q9BQ87\|TBL1Y_HUMAN	F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1	100	333	1.0E-10
sp\|P52287\|GBB3_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1	101	305	1.0E-10
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	58	308	1.0E-10
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	202	353	1.0E-10
sp\|Q9PTR5\|LIS1_CHICK	Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3	55	261	1.0E-10
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	101	305	1.0E-10
sp\|O24076\|GBLP_MEDSA	Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1	145	340	1.0E-10
sp\|B2VWG7\|LIS1_PYRTR	Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1	55	242	1.0E-10
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	101	353	1.0E-10
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	57	333	1.0E-10
sp\|Q6CKE8\|PRP46_KLULA	Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1	145	332	1.0E-10
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	60	221	1.0E-10
sp\|O54929\|WSB2_MOUSE	WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2	119	333	1.0E-10
sp\|A2R3Z3\|MDV1_ASPNC	Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2	55	313	1.0E-10
sp\|Q0V8J1\|WSB2_BOVIN	WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1	119	333	1.0E-10
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	104	354	1.0E-10
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	139	327	2.0E-10
sp\|P78706\|RCO1_NEUCR	Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2	58	241	2.0E-10
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	101	305	2.0E-10
sp\|P79147\|GBB3_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1	101	305	2.0E-10
sp\|O75529\|TAF5L_HUMAN	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1	163	354	2.0E-10
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	60	263	2.0E-10
sp\|Q5REG7\|LIS1_PONAB	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3	55	261	2.0E-10
sp\|P63004\|LIS1_RAT	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2	55	261	2.0E-10
sp\|P63005\|LIS1_MOUSE	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2	55	261	2.0E-10
sp\|B0LSW3\|LIS1_FELCA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1	55	261	2.0E-10
sp\|P43034\|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2	55	261	2.0E-10
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	55	261	2.0E-10
sp\|Q09990\|LIN23_CAEEL	F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2	108	354	2.0E-10
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	60	263	2.0E-10
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	101	308	2.0E-10
sp\|Q9LV28\|GPLPC_ARATH	Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1	146	340	2.0E-10
sp\|Q9Y297\|FBW1A_HUMAN	F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1	58	260	2.0E-10
sp\|P0CS42\|LIS1_CRYNJ	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1	48	237	2.0E-10
sp\|P0CS43\|LIS1_CRYNB	Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1	48	237	2.0E-10
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	139	333	2.0E-10
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	52	222	2.0E-10
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	57	333	2.0E-10
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	57	333	2.0E-10
sp\|Q5RE95\|WDR5B_PONAB	WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1	226	354	3.0E-10
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	123	354	3.0E-10
sp\|B5X3Z6\|LIS1A_SALSA	Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1	55	261	3.0E-10
sp\|P90648\|MHCKB_DICDI	Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1	55	258	3.0E-10
sp\|B8PD53\|LIS12_POSPM	Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1	58	274	3.0E-10
sp\|Q39836\|GBLP_SOYBN	Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1	146	340	3.0E-10
sp\|O22212\|PRP4L_ARATH	U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1	70	350	3.0E-10
sp\|Q9C4Z6\|GPLPB_ARATH	Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1	144	340	3.0E-10
sp\|P54313\|GBB2_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4	139	333	3.0E-10
sp\|P62880\|GBB2_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3	139	333	3.0E-10
sp\|P62879\|GBB2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3	139	333	3.0E-10
sp\|P11017\|GBB2_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3	139	333	3.0E-10
sp\|Q91854\|TRCB_XENLA	Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1	58	260	3.0E-10
sp\|Q6CKE8\|PRP46_KLULA	Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1	192	353	3.0E-10
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	39	221	3.0E-10
sp\|Q5IS43\|LIS1_PANTR	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3	55	261	4.0E-10
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	101	316	4.0E-10
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	57	316	4.0E-10
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	57	316	4.0E-10
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	57	316	4.0E-10
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	56	308	4.0E-10
sp\|Q5AXW3\|MDV1_EMENI	Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2	58	313	4.0E-10
sp\|Q8RXA7\|SCD1_ARATH	DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1	44	313	4.0E-10
sp\|Q2KIG2\|WDR5_BOVIN	WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1	225	354	5.0E-10
sp\|Q498M4\|WDR5_RAT	WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1	225	354	5.0E-10
sp\|P61965\|WDR5_MOUSE	WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1	225	354	5.0E-10
sp\|P61964\|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1	225	354	5.0E-10
sp\|Q969H0\|FBXW7_HUMAN	F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1	58	228	5.0E-10
sp\|P52287\|GBB3_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1	123	354	5.0E-10
sp\|Q6NZH4\|LIS1_XENTR	Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3	55	261	5.0E-10
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	55	261	5.0E-10
sp\|Q7T394\|LIS1A_DANRE	Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3	55	261	5.0E-10
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	55	261	5.0E-10
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	204	354	5.0E-10
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	61	216	5.0E-10
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	61	216	5.0E-10
sp\|Q9JHB4\|WDR31_MOUSE	WD repeat-containing protein 31 OS=Mus musculus GN=Wdr31 PE=2 SV=1	116	345	5.0E-10
sp\|Q8VBV4\|FBXW7_MOUSE	F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1	58	228	6.0E-10
sp\|Q90ZL4\|LIS1_XENLA	Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3	55	219	6.0E-10
sp\|Q91WQ5\|TAF5L_MOUSE	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1	143	353	6.0E-10
sp\|Q86VZ2\|WDR5B_HUMAN	WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1	226	354	7.0E-10
sp\|F1MNN4\|FBXW7_BOVIN	F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2	58	228	7.0E-10
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	192	332	7.0E-10
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	58	328	7.0E-10
sp\|Q01277\|SCONB_NEUCR	Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1	58	354	7.0E-10
sp\|A6ZQL5\|MDV1_YEAS7	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1	126	354	7.0E-10
sp\|P87177\|YB1C_SCHPO	Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1	68	319	7.0E-10
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	129	308	7.0E-10
sp\|Q9JJA4\|WDR12_MOUSE	Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1	55	300	7.0E-10
sp\|B3S4I5\|LIS1_TRIAD	Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1	175	326	8.0E-10
sp\|P93340\|GBLP_NICPL	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1	60	263	8.0E-10
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	61	350	8.0E-10
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	61	216	9.0E-10
sp\|Q7S8R5\|MDV1_NEUCR	Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2	55	314	9.0E-10
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	55	348	9.0E-10
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	58	348	9.0E-10
sp\|P16520\|GBB3_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1	123	354	1.0E-09
sp\|Q93134\|GBLP_BIOGL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1	145	335	1.0E-09
sp\|P79147\|GBB3_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1	123	354	1.0E-09
sp\|Q803D2\|LIS1B_DANRE	Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3	55	261	1.0E-09
sp\|O13615\|PRP46_SCHPO	Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1	55	210	1.0E-09
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	139	333	1.0E-09
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	139	333	1.0E-09
sp\|P23232\|GBB_LOLFO	Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1	101	308	1.0E-09
sp\|P49026\|GBLP_TOBAC	Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1	60	263	1.0E-09
sp\|B4HND9\|WDR48_DROSE	WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1	58	305	1.0E-09
sp\|B4QB64\|WDR48_DROSI	WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1	58	305	1.0E-09
sp\|Q5ZMC3\|WSDU1_CHICK	WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2	54	308	1.0E-09
sp\|A7MB12\|UTP15_BOVIN	U3 small nucleolar RNA-associated protein 15 homolog OS=Bos taurus GN=UTP15 PE=2 SV=1	38	317	1.0E-09
sp\|P29387\|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4	101	305	1.0E-09
sp\|C5PFX0\|LIS1_COCP7	Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2	55	242	1.0E-09
sp\|P20053\|PRP4_YEAST	U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1	48	258	1.0E-09
sp\|P61480\|WDR12_RAT	Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1	55	300	1.0E-09
sp\|O74855\|NLE1_SCHPO	Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1	192	354	2.0E-09
sp\|P63245\|GBLP_RAT	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3	145	335	2.0E-09
sp\|P63246\|GBLP_PIG	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3	145	335	2.0E-09
sp\|P68040\|GBLP_MOUSE	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3	145	335	2.0E-09
sp\|Q4R7Y4\|GBLP_MACFA	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3	145	335	2.0E-09
sp\|P63244\|GBLP_HUMAN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3	145	335	2.0E-09
sp\|P63247\|GBLP_CHICK	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1	145	335	2.0E-09
sp\|P63243\|GBLP_BOVIN	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3	145	335	2.0E-09
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	55	261	2.0E-09
sp\|P17343\|GBB1_CAEEL	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2	58	309	2.0E-09
sp\|Q61ZF6\|GBB1_CAEBR	Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1	58	309	2.0E-09
sp\|D4D8P3\|SCONB_TRIVH	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1	143	327	2.0E-09
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	55	261	2.0E-09
sp\|Q9HAV0\|GBB4_HUMAN	Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3	32	328	2.0E-09
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	101	305	2.0E-09
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	101	305	2.0E-09
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	101	305	2.0E-09
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	101	305	2.0E-09
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	101	305	2.0E-09
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	101	305	2.0E-09
sp\|Q5SUS0\|FBW10_MOUSE	F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1	178	332	2.0E-09
sp\|P49027\|GBLPA_ORYSJ	Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1	60	264	2.0E-09
sp\|O35353\|GBB4_RAT	Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4	101	305	2.0E-09
sp\|O43818\|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens GN=RRP9 PE=1 SV=1	3	348	2.0E-09
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	206	350	2.0E-09
sp\|Q9JHB4\|WDR31_MOUSE	WD repeat-containing protein 31 OS=Mus musculus GN=Wdr31 PE=2 SV=1	155	332	2.0E-09
sp\|Q61011\|GBB3_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2	58	328	3.0E-09
sp\|P36408\|GBB_DICDI	Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1	139	333	3.0E-09
sp\|O24456\|GBLPA_ARATH	Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2	146	340	3.0E-09
sp\|Q8HXX0\|LIS1_MACFA	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3	175	348	3.0E-09
sp\|Q9GL51\|LIS1_PIG	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3	175	348	3.0E-09
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	52	216	3.0E-09
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	52	216	3.0E-09
sp\|D4AM37\|SCONB_ARTBC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1	143	327	3.0E-09
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	139	333	3.0E-09
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	101	305	3.0E-09
sp\|Q2KJJ5\|TBL3_BOVIN	Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1	61	216	3.0E-09
sp\|Q91WM3\|U3IP2_MOUSE	U3 small nucleolar RNA-interacting protein 2 OS=Mus musculus GN=Rrp9 PE=1 SV=1	224	348	3.0E-09
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	189	348	3.0E-09
sp\|P93397\|GBB1_TOBAC	Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1	100	332	3.0E-09
sp\|Q58D20\|NLE1_BOVIN	Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3	226	333	4.0E-09
sp\|Q4X0A9\|SCONB_ASPFU	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1	89	327	4.0E-09
sp\|B0XTS1\|SCONB_ASPFC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1	89	327	4.0E-09
sp\|O45040\|GBB1_HOMAM	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1	32	309	4.0E-09
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	192	352	4.0E-09
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	139	354	4.0E-09
sp\|Q9UMS4\|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1	133	332	4.0E-09
sp\|P38129\|TAF5_YEAST	Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1	54	237	4.0E-09
sp\|P47025\|MDV1_YEAST	Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1	126	354	4.0E-09
sp\|Q9SZQ5\|VIP3_ARATH	WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1	50	241	4.0E-09
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	143	348	5.0E-09
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	139	354	5.0E-09
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	139	354	5.0E-09
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	139	354	5.0E-09
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	139	354	5.0E-09
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	139	354	5.0E-09
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	139	354	5.0E-09
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	139	354	6.0E-09
sp\|Q08E38\|PRP19_BOVIN	Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1	133	332	6.0E-09
sp\|Q55FR9\|COPA_DICDI	Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1	52	320	6.0E-09
sp\|P42527\|MHCKA_DICDI	Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2	79	221	6.0E-09
sp\|Q9BRX9\|WDR83_HUMAN	WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1	55	258	7.0E-09
sp\|Q2KID6\|PLRG1_BOVIN	Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1	192	353	7.0E-09
sp\|C5FP68\|SCONB_ARTOC	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1	143	327	7.0E-09
sp\|Q15269\|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2	52	313	7.0E-09
sp\|Q5RFF8\|NLE1_PONAB	Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3	226	333	8.0E-09
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	151	327	8.0E-09
sp\|O43660\|PLRG1_HUMAN	Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1	192	353	8.0E-09
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	139	333	8.0E-09
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	192	353	8.0E-09
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	192	353	8.0E-09
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	140	354	8.0E-09
sp\|B3MET8\|WDR48_DROAN	WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1	58	305	8.0E-09
sp\|Q6FJZ9\|PRP46_CANGA	Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1	41	216	8.0E-09
sp\|Q28I85\|POC1A_XENTR	POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1	34	228	9.0E-09
sp\|Q39336\|GBLP_BRANA	Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1	146	340	9.0E-09
sp\|Q6P5M2\|WDR61_DANRE	WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1	66	259	9.0E-09
sp\|O14170\|POP2_SCHPO	WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1	55	190	9.0E-09
sp\|Q5XGI5\|WDR83_XENTR	WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1	55	258	1.0E-08
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	61	345	1.0E-08
sp\|O88879\|APAF_MOUSE	Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3	61	345	1.0E-08
sp\|A1DHW6\|SCONB_NEOFI	Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1	89	327	1.0E-08
sp\|Q1LZ08\|WDR48_DROME	WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1	58	305	1.0E-08
sp\|B3NSK1\|WDR48_DROER	WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1	58	305	1.0E-08
sp\|Q28YY2\|WDR48_DROPS	WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2	58	305	1.0E-08
sp\|B4GIJ0\|WDR48_DROPE	WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1	58	305	1.0E-08
sp\|Q25306\|GBLP_LEIMA	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1	163	354	1.0E-08
sp\|Q9JMJ4\|PRP19_RAT	Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2	133	332	1.0E-08
sp\|Q99KP6\|PRP19_MOUSE	Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1	133	332	1.0E-08
sp\|P62884\|GBLP_LEIIN	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1	192	354	1.0E-08
sp\|P62883\|GBLP_LEICH	Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1	192	354	1.0E-08
sp\|Q8W1K8\|MUT11_CHLRE	Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1	53	217	2.0E-08
sp\|Q9NVX2\|NLE1_HUMAN	Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4	226	333	2.0E-08
sp\|P62882\|GBB5_RAT	Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1	141	354	2.0E-08
sp\|P36408\|GBB_DICDI	Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1	101	318	2.0E-08
sp\|Q8LPL5\|FZR3_ARATH	Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1	103	342	2.0E-08
sp\|Q6PH57\|GBB1_DANRE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1	58	328	2.0E-08
sp\|Q42384\|PRL1_ARATH	Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1	52	216	2.0E-08
sp\|B4P7H8\|WDR48_DROYA	WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1	58	305	2.0E-08
sp\|Q6C709\|PRP46_YARLI	Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2	199	354	2.0E-08
sp\|B4MFM2\|WDR48_DROVI	WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1	58	305	2.0E-08
sp\|B4J8H6\|WDR48_DROGR	WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1	58	305	2.0E-08
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	101	345	2.0E-08
sp\|Q0VC24\|WDR12_BOVIN	Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1	55	300	2.0E-08
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	61	260	2.0E-08
sp\|Q9VZF4\|FBXW7_DROME	F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1	58	219	3.0E-08
sp\|Q21215\|GBLP_CAEEL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3	57	260	3.0E-08
sp\|P62881\|GBB5_MOUSE	Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1	141	354	3.0E-08
sp\|Q9WUC8\|PLRG1_RAT	Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1	52	216	3.0E-08
sp\|Q9UT85\|YIPC_SCHPO	Uncharacterized WD repeat-containing protein C343.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC343.04c PE=3 SV=1	177	318	3.0E-08
sp\|A4R3M4\|LIS1_MAGO7	Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3	55	241	3.0E-08
sp\|Q12788\|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2	61	353	3.0E-08
sp\|O74319\|TAF73_SCHPO	Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1	144	348	3.0E-08
sp\|Q5ZMA2\|PRP19_CHICK	Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1	150	332	3.0E-08
sp\|B4KRQ4\|WDR48_DROMO	WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1	58	260	3.0E-08
sp\|O35353\|GBB4_RAT	Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4	139	333	3.0E-08
sp\|P29387\|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4	139	333	3.0E-08
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	58	260	3.0E-08
sp\|Q00808\|HETE1_PODAS	Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1	213	333	4.0E-08
sp\|Q5RDY7\|GBB5_PONAB	Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1	141	354	4.0E-08
sp\|Q80ZD0\|GBB5_TAMST	Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1	141	354	4.0E-08
sp\|O14775\|GBB5_HUMAN	Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2	141	354	4.0E-08
sp\|Q6PNB6\|GBB5_RABIT	Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1	141	354	4.0E-08
sp\|P26308\|GBB1_DROME	Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1	58	309	4.0E-08
sp\|A7S338\|LIS1_NEMVE	Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1	175	348	4.0E-08
sp\|Q5A7Q3\|PRP46_CANAL	Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1	124	354	4.0E-08
sp\|Q40507\|GBB3_TOBAC	Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1	100	332	4.0E-08
sp\|C4YFX2\|TUP1_CANAW	Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1	59	175	5.0E-08
sp\|P0CY34\|TUP1_CANAL	Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1	59	175	5.0E-08
sp\|Q7ZXK9\|NLE1_XENLA	Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1	226	333	5.0E-08
sp\|Q922V4\|PLRG1_MOUSE	Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1	52	216	5.0E-08
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	61	287	5.0E-08
sp\|Q6NLV4\|FY_ARATH	Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1	163	354	5.0E-08
sp\|Q75LV5\|YAO_ORYSJ	U3 snoRNP-associated protein-like YAOH OS=Oryza sativa subsp. japonica GN=Os03g0625900 PE=2 SV=1	62	225	5.0E-08
sp\|Q8N0X2\|SPG16_HUMAN	Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2	189	348	5.0E-08
sp\|Q5RFQ3\|PWP2_PONAB	Periodic tryptophan protein 2 homolog OS=Pongo abelii GN=PWP2 PE=2 SV=1	52	313	5.0E-08
sp\|Q9D994\|WDR38_MOUSE	WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1	280	353	6.0E-08
sp\|Q08706\|GBB_LYMST	Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1	139	333	6.0E-08
sp\|Q6TMK6\|GBB1_CRIGR	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3	58	328	6.0E-08
sp\|O35353\|GBB4_RAT	Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4	32	328	6.0E-08
sp\|Q5XGI5\|WDR83_XENTR	WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1	149	352	7.0E-08
sp\|Q09715\|TUP11_SCHPO	Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1	55	179	7.0E-08
sp\|A0DB19\|LIS11_PARTE	Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1	195	353	7.0E-08
sp\|P29387\|GBB4_MOUSE	Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4	32	328	7.0E-08
sp\|Q6ZMY6\|WDR88_HUMAN	WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2	61	220	8.0E-08
sp\|Q8K450\|SPG16_MOUSE	Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1	192	333	8.0E-08
sp\|A8XZJ9\|LIS1_CAEBR	Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2	175	332	9.0E-08
sp\|Q8CIE6\|COPA_MOUSE	Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2	37	322	9.0E-08
sp\|Q27954\|COPA_BOVIN	Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1	37	322	9.0E-08
sp\|Q9NDC9\|LIS1_CAEEL	Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1	175	350	1.0E-07
sp\|Q5GIS3\|GBB_PINFU	Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1	139	333	1.0E-07
sp\|Q9FLX9\|NLE1_ARATH	Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1	226	333	1.0E-07
sp\|P53621\|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2	37	322	1.0E-07
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	61	287	1.0E-07
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	61	307	1.0E-07
sp\|Q5U2W5\|TBL3_RAT	Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1	61	261	1.0E-07
sp\|O43017\|SWD3_SCHPO	Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1	139	319	1.0E-07
sp\|Q758R7\|MDV1_ASHGO	Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1	55	221	1.0E-07
sp\|C3XVT5\|LIS1_BRAFL	Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1	225	353	2.0E-07
sp\|P93107\|PF20_CHLRE	Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1	55	309	2.0E-07
sp\|Q5R5W8\|GBB1_PONAB	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3	58	328	2.0E-07
sp\|P54311\|GBB1_RAT	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4	58	328	2.0E-07
sp\|P62874\|GBB1_MOUSE	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3	58	328	2.0E-07
sp\|P62873\|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3	58	328	2.0E-07
sp\|P62872\|GBB1_CANLF	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3	58	328	2.0E-07
sp\|P62871\|GBB1_BOVIN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3	58	328	2.0E-07
sp\|Q5ZMC3\|WSDU1_CHICK	WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2	67	260	2.0E-07
sp\|P29829\|GBB2_DROME	Guanine nucleotide-binding protein subunit beta-2 OS=Drosophila melanogaster GN=Gbeta76C PE=1 SV=3	100	335	2.0E-07
sp\|P61480\|WDR12_RAT	Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1	77	349	2.0E-07
sp\|B7PS00\|LIS1_IXOSC	Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2	55	261	3.0E-07
sp\|P49846\|TAF5_DROME	Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1	101	308	3.0E-07
sp\|O14727\|APAF_HUMAN	Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2	55	345	3.0E-07
sp\|P39014\|MET30_YEAST	F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1	139	327	3.0E-07
sp\|P79959\|GBB1_XENLA	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1	58	328	3.0E-07
sp\|Q921C3\|BRWD1_MOUSE	Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2	53	320	3.0E-07
sp\|Q9SJT9\|COPA2_ARATH	Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1	61	287	3.0E-07
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	61	350	3.0E-07
sp\|P0CS36\|HAT2_CRYNJ	Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1	246	354	3.0E-07
sp\|P0CS37\|HAT2_CRYNB	Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1	246	354	3.0E-07
sp\|Q4WEI5\|HAT2_ASPFU	Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1	54	260	3.0E-07
sp\|Q9USN3\|UTP13_SCHPO	Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3	58	318	3.0E-07
sp\|Q7ZVA0\|SMU1_DANRE	WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1	192	345	3.0E-07
sp\|Q6DH44\|WDR83_DANRE	WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1	57	262	4.0E-07
sp\|Q94A40\|COPA1_ARATH	Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2	61	321	4.0E-07
sp\|O43017\|SWD3_SCHPO	Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1	192	322	4.0E-07
sp\|Q9NSI6\|BRWD1_HUMAN	Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4	53	320	4.0E-07
sp\|O94423\|MFR1_SCHPO	Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1	143	354	4.0E-07
sp\|P87053\|POF1_SCHPO	F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1	202	354	5.0E-07
sp\|Q21215\|GBLP_CAEEL	Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3	54	319	5.0E-07
sp\|P38123\|SWD3_YEAST	COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1	161	327	5.0E-07
sp\|Q4RJN5\|LIS1_TETNG	Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1	197	353	6.0E-07
sp\|P23232\|GBB_LOLFO	Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1	139	333	6.0E-07
sp\|B0X2V9\|WDR48_CULQU	WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1	44	220	7.0E-07
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	225	354	8.0E-07
sp\|Q2GTM8\|EIF3I_CHAGB	Eukaryotic translation initiation factor 3 subunit I OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF34 PE=3 SV=1	54	256	8.0E-07
sp\|Q9JJA4\|WDR12_MOUSE	Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1	120	345	8.0E-07
sp\|Q0D0X6\|LIS1_ASPTN	Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1	53	254	9.0E-07
sp\|O13286\|SRW1_SCHPO	WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1	107	345	1.0E-06
sp\|Q8SRB0\|GBLP_ENCCU	Guanine nucleotide-binding protein subunit beta-like protein OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1110 PE=1 SV=1	145	345	1.0E-06
sp\|B2AEZ5\|LIS11_PODAN	Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2	55	241	1.0E-06
sp\|Q75LV5\|YAO_ORYSJ	U3 snoRNP-associated protein-like YAOH OS=Oryza sativa subsp. japonica GN=Os03g0625900 PE=2 SV=1	55	301	1.0E-06
sp\|Q4WEI5\|HAT2_ASPFU	Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1	140	353	1.0E-06
sp\|A8PTE4\|MDV1_MALGO	Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1	120	260	1.0E-06
sp\|Q9Y6I7\|WSB1_HUMAN	WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1	111	346	1.0E-06
sp\|P20053\|PRP4_YEAST	U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1	101	350	1.0E-06
sp\|Q2HBX6\|LIS11_CHAGB	Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1	55	241	1.0E-06
sp\|Q17N69\|LIS1_AEDAE	Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2	175	323	2.0E-06
sp\|Q9AUR8\|COPA1_ORYSJ	Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1	55	320	2.0E-06
sp\|Q15269\|PWP2_HUMAN	Periodic tryptophan protein 2 homolog OS=Homo sapiens GN=PWP2 PE=2 SV=2	55	307	2.0E-06
sp\|Q9SY00\|WDR5B_ARATH	COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1	55	216	3.0E-06
sp\|B4MY65\|LIS1_DROWI	Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1	175	323	3.0E-06
sp\|Q8L3Z8\|FZR2_ARATH	Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1	75	342	3.0E-06
sp\|B3MEY6\|LIS1_DROAN	Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1	175	323	3.0E-06
sp\|P74598\|Y1491_SYNY3	Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1	55	264	3.0E-06
sp\|Q8C4J7\|TBL3_MOUSE	Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1	114	354	3.0E-06
sp\|Q7PS24\|CIAO1_ANOGA	Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3	93	308	3.0E-06
sp\|Q4V7Y7\|KTNB1_XENLA	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1	52	177	4.0E-06
sp\|Q4WT34\|PRP46_ASPFU	Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1	55	216	4.0E-06
sp\|A0CH87\|LIS12_PARTE	Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1	55	308	4.0E-06
sp\|A8IZG4\|CIAO1_CHLRE	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1	96	312	4.0E-06
sp\|Q12417\|PRP46_YEAST	Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1	41	216	4.0E-06
sp\|Q7T2F6\|WSB1_DANRE	WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1	111	344	4.0E-06
sp\|Q09855\|POF11_SCHPO	F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2	48	183	5.0E-06
sp\|Q9EPV5\|APAF_RAT	Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1	55	310	5.0E-06
sp\|A0DB19\|LIS11_PARTE	Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1	55	308	5.0E-06
sp\|Q6NVM2\|KTNB1_XENTR	Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1	52	177	6.0E-06
sp\|D1ZEB4\|LIS11_SORMK	Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1	192	348	6.0E-06
sp\|Q9AUR7\|COPA2_ORYSJ	Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1	52	320	6.0E-06
sp\|Q0J3D9\|COPA3_ORYSJ	Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1	55	320	6.0E-06
sp\|P0CS36\|HAT2_CRYNJ	Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1	47	190	6.0E-06
sp\|P0CS37\|HAT2_CRYNB	Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1	47	190	6.0E-06
sp\|Q54S79\|WDR3_DICDI	WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	28	175	6.0E-06
sp\|P43033\|LIS1_BOVIN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2	197	354	7.0E-06
sp\|Q4I7L0\|HAT2_GIBZE	Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1	140	353	7.0E-06
sp\|Q7RXH4\|EIF3I_NEUCR	Eukaryotic translation initiation factor 3 subunit I OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-34 PE=3 SV=1	54	256	8.0E-06
sp\|P25382\|NLE1_YEAST	Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3	145	327	1.0E-05

[Show less]

GO

GO Term	Description	Terminal node
GO:0005515	protein binding	Yes
GO:0005488	binding	No
GO:0003674	molecular_function	No

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
No	1 - 13	0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>OphauG2\|4109 MSAEKRPAEDDPSASQSLVKRQNVGPSEGALARLNGSGGSLVQTAPRTSNLKAPVMELSGHSGEIFAARFDPTAN LIASGSMDRSIMLWKTYGDCENYGLLNGHKGAVLALQWSRDSDILFSASADMHLASWDLTSGTRIRRYVGHEEAI NAMDISRRGEELLVSGSDDSSICIWDPRSKHAVDYIQTDFPITAVAISEAGNEIFSGSIDNDIKVWDLRKKSVVY SMLGHSDTVTSLRVSPDSQSLLSYALDSTVRTWDIRPFAPTERHMRTFDGATAGGEVNLLGASWNPDGKRIAAGS GDGTVIIWSSESGKMLYKLPGHKGTVNCAEFSPGKDPIILSASSDRNMLLGELK*
Coding	>OphauG2\|4109 ATGTCAGCCGAGAAGCGCCCAGCAGAAGACGACCCAAGCGCATCCCAGTCGCTTGTCAAAAGACAGAATGTCGGT CCGTCCGAGGGCGCGCTGGCTCGTCTCAATGGCTCAGGAGGGTCTCTAGTACAGACTGCTCCACGGACCAGCAAC CTAAAAGCGCCAGTCATGGAGCTGTCAGGCCACTCGGGCGAGATTTTCGCCGCCAGATTCGACCCAACTGCCAAT CTGATAGCCTCCGGTTCAATGGATAGAAGCATTATGCTATGGAAAACGTACGGCGACTGCGAAAACTATGGGCTG CTCAACGGGCACAAGGGCGCAGTTCTTGCCTTGCAATGGTCCCGTGACTCAGACATTCTCTTTTCTGCTTCCGCA GATATGCATCTCGCCAGCTGGGATCTGACATCGGGAACGCGAATCCGCCGATATGTTGGACACGAAGAAGCCATT AATGCAATGGATATAAGCCGAAGAGGCGAGGAGCTACTTGTCAGTGGTAGTGATGACTCTAGCATTTGCATATGG GACCCGAGATCGAAGCATGCTGTCGACTATATACAAACAGATTTTCCAATCACGGCTGTGGCCATTTCTGAAGCG GGCAATGAGATTTTTTCGGGGAGCATTGACAATGACATCAAAGTATGGGATCTTAGGAAAAAGTCGGTTGTGTAT TCAATGCTGGGCCACTCGGATACAGTCACTTCTCTACGAGTATCGCCAGACTCGCAGTCTCTTCTCTCGTATGCT TTGGATTCGACGGTAAGAACTTGGGATATCCGACCTTTCGCCCCCACCGAGAGGCATATGCGCACATTCGATGGG GCGACTGCAGGAGGTGAAGTAAATTTACTTGGGGCGAGTTGGAACCCAGATGGGAAAAGAATAGCTGCTGGCTCT GGTGACGGTACCGTCATCATTTGGTCCAGCGAAAGTGGCAAAATGCTCTACAAACTTCCAGGCCACAAAGGTACC GTCAACTGCGCCGAGTTTTCTCCCGGCAAGGATCCCATTATTCTTTCCGCCTCATCCGATCGCAACATGCTTCTC GGTGAATTGAAGTGA
Transcript	>OphauG2\|4109 ATGTCAGCCGAGAAGCGCCCAGCAGAAGACGACCCAAGCGCATCCCAGTCGCTTGTCAAAAGACAGAATGTCGGT CCGTCCGAGGGCGCGCTGGCTCGTCTCAATGGCTCAGGAGGGTCTCTAGTACAGACTGCTCCACGGACCAGCAAC CTAAAAGCGCCAGTCATGGAGCTGTCAGGCCACTCGGGCGAGATTTTCGCCGCCAGATTCGACCCAACTGCCAAT CTGATAGCCTCCGGTTCAATGGATAGAAGCATTATGCTATGGAAAACGTACGGCGACTGCGAAAACTATGGGCTG CTCAACGGGCACAAGGGCGCAGTTCTTGCCTTGCAATGGTCCCGTGACTCAGACATTCTCTTTTCTGCTTCCGCA GATATGCATCTCGCCAGCTGGGATCTGACATCGGGAACGCGAATCCGCCGATATGTTGGACACGAAGAAGCCATT AATGCAATGGATATAAGCCGAAGAGGCGAGGAGCTACTTGTCAGTGGTAGTGATGACTCTAGCATTTGCATATGG GACCCGAGATCGAAGCATGCTGTCGACTATATACAAACAGATTTTCCAATCACGGCTGTGGCCATTTCTGAAGCG GGCAATGAGATTTTTTCGGGGAGCATTGACAATGACATCAAAGTATGGGATCTTAGGAAAAAGTCGGTTGTGTAT TCAATGCTGGGCCACTCGGATACAGTCACTTCTCTACGAGTATCGCCAGACTCGCAGTCTCTTCTCTCGTATGCT TTGGATTCGACGGTAAGAACTTGGGATATCCGACCTTTCGCCCCCACCGAGAGGCATATGCGCACATTCGATGGG GCGACTGCAGGAGGTGAAGTAAATTTACTTGGGGCGAGTTGGAACCCAGATGGGAAAAGAATAGCTGCTGGCTCT GGTGACGGTACCGTCATCATTTGGTCCAGCGAAAGTGGCAAAATGCTCTACAAACTTCCAGGCCACAAAGGTACC GTCAACTGCGCCGAGTTTTCTCCCGGCAAGGATCCCATTATTCTTTCCGCCTCATCCGATCGCAACATGCTTCTC GGTGAATTGAAGTGA
Gene	>OphauG2\|4109 ATGTCAGCCGAGAAGCGCCCAGCAGAAGACGACCCAAGCGCATCCCAGTCGCTTGTCAAAAGACAGAATGTCGGT CCGTCCGAGGGCGCGCTGGCTCGTCTCAATGGCTCAGGAGGGTCTCTAGTACAGACTGTAGGCAATTTCAAGCTT GGCCATGTCACACGCATCTGACTTTGTTCGCCAGGCTCCACGGACCAGCAACCTAAAAGCGCCAGTCATGGAGCT GTCAGGCCACTCGGGCGAGATTTTCGCCGCCAGATTCGACCCAACTGCCAATCTGATAGCCTCCGGTTCAATGGA TAGAAGCATTAGTACCGCTTATGAGCTCTTACTGCGGCTTGAGGCGCTCGCTAACCCGTTACAGTGCTATGGAAA ACGTACGGCGACTGCGAAAACTATGGGCTGCTCAACGGGCACAAGGGCGCAGTTCTTGCCTTGCAATGGTCCCGT GACTCAGACATTCTCTTTTCTGCTTCCGCAGATATGCATCTCGCCAGCTGGGATCTGACATCGGGAACGCGAATC CGCCGATATGTTGGACACGAAGAAGCCATTAATGCAATGGATATAAGCCGAAGAGGCGAGGAGCTACTTGTCAGT GGTAGTGATGACTCTAGCATTTGCATATGGGACCCGAGATCGAAGCATGCTGTCGACTATATACAAACAGATTTT CCAATCACGGCTGTGGCCATTTCTGAAGCGGGCAATGAGATTTTTTCGGGGAGCATTGACAATGACATCAAAGTA TGGGATCTTAGGAAAAAGTCGGTTGTGTATTCAATGCTGGGCCACTCGGATACAGTCACTTCTCTACGAGTATCG CCAGACTCGCAGTCTCTTCTCTCGTATGCTTTGGATTCGACGGTAAGAACTTGGGATATCCGACCTTTCGCCCCC ACCGAGAGGCATATGCGCACATTCGATGGGGCGACTGCAGGAGGTGAAGTAAATTTACTTGGGGCGAGTTGGAAC CCAGATGGGAAAAGAATAGCTGCTGGCTCTGGTGACGGTACCGTCATCATTTGGTCCAGCGAAAGTGGCAAAATG CTCTACAAACTTCCAGGCCACAAAGGTACCGTCAACTGCGCCGAGTTTTCTCCCGGCAAGGATCCCATTAGTAAG TTCAATGCCGATATACAAGGCCTGGGCGAGGCTTCAAACTAACCTGGACGGACAGTTCTTTCCGCCTCATCCGAT CGCAACATGCTTCTCGGTGAATTGAAGTGA

Fungal Genomics

General Properties

PFAM Domains

Swissprot hits

GO

SignalP

Transmembrane Domains

Transcription Factor Class

Expression data

Sequences