Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4103
Gene name
LocationContig_33:44250..47252
Strand-
Gene length (bp)3002
Transcript length (bp)2889
Coding sequence length (bp)2889
Protein length (aa) 963

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 4.5E-94 63 523
PF12456 hSac2 Inositol phosphatase 4.2E-37 691 805

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 244 780 2.0E-83
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 252 780 6.0E-82
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 252 780 5.0E-81
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 226 674 6.0E-64
sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 255 678 4.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 244 780 2.0E-83
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 252 780 6.0E-82
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 252 780 5.0E-81
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 226 674 6.0E-64
sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 255 678 4.0E-58
sp|Q9NTJ5|SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens GN=SACM1L PE=1 SV=2 259 686 5.0E-57
sp|Q5R921|SAC1_PONAB Phosphatidylinositide phosphatase SAC1 OS=Pongo abelii GN=SACM1L PE=2 SV=1 259 686 5.0E-57
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 255 686 7.0E-57
sp|Q9C5G5|SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana GN=SAC7 PE=2 SV=1 222 679 2.0E-56
sp|Q9EP69|SAC1_MOUSE Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=1 SV=1 255 686 2.0E-56
sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 255 681 9.0E-56
sp|Q9W0I6|SAC1_DROME Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=2 SV=1 256 673 9.0E-56
sp|P32368|SAC1_YEAST Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC1 PE=1 SV=1 232 673 2.0E-55
sp|A1L244|SAC1A_DANRE Phosphatidylinositide phosphatase SAC1-A OS=Danio rerio GN=sacm1la PE=2 SV=1 255 689 7.0E-55
sp|O60162|YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.03 PE=1 SV=1 259 673 7.0E-55
sp|A4VCH0|SAC1B_DANRE Phosphatidylinositide phosphatase SAC1-B OS=Danio rerio GN=sacm1lb PE=2 SV=2 255 697 1.0E-54
sp|Q7X911|SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana GN=SAC6 PE=2 SV=1 258 679 2.0E-54
sp|Q96328|SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana GN=SAC8 PE=2 SV=1 246 677 2.0E-49
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 255 675 2.0E-47
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 373 675 5.0E-41
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 387 675 2.0E-40
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 256 677 7.0E-40
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 378 682 3.0E-39
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 378 682 7.0E-39
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 378 761 3.0E-38
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 378 761 4.0E-38
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 378 672 5.0E-38
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 378 761 7.0E-38
sp|O14127|YF51_SCHPO Uncharacterized protein C3C7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.01c PE=3 SV=2 373 661 1.0E-37
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 378 761 2.0E-37
sp|Q92562|FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1 179 673 6.0E-31
sp|Q91WF7|FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1 179 673 1.0E-30
sp|Q8RW97|SAC5_ARATH Phosphoinositide phosphatase SAC5 OS=Arabidopsis thaliana GN=SAC5 PE=2 SV=1 235 679 3.0E-30
sp|P42837|FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIG4 PE=1 SV=1 256 678 4.0E-30
sp|Q7XZU1|SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1 256 673 2.0E-25
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 376 673 2.0E-22
sp|Q94A27|SAC2_ARATH Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1 244 537 4.0E-21
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 256 537 3.0E-20
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 244 523 1.0E-18
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 249 679 2.0E-15
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 558 673 6.0E-10
sp|Q94A27|SAC2_ARATH Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1 558 673 6.0E-09
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 558 673 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4103
MPGLARKIIVCAAIDGLIIQPLSSRGQRPLQPVRVRYADSSISAVPRDQIPDTSTPDSSFEAFGVIGLITVSRLS
YLITITRRQQVAQIQGLPVYVVTDVAITPCTSQSDAAESIKRTAGLLRQSLPHTLSDDGLGSDDEMDVSHDILDE
AEDDVLASEEDGIRPDSARSSVAEDVFRRRGSYGRFAQSWFGRSGWTLEQRRSMGMSISSNGPAAPVDADSTATR
PLPPDDDSTQAPASTLLPKLLRTVRVLFGSSRSFYFSYDVDLTRSLSQEALVPGADAALHAQVDKTFFWNRHMLR
PFTATGQDPLALPLMLGFVGQRTFVVDSQPPQVNEHPLGSAEMCTLSAAPSRSGSPPTAKPRALAQLRPTETELL
VTLISRRSTKRAGLRYLRRGVDEDGFVANMVETEQMLSSPTWDPSMPIHSFVQIRGSIPLFFTQSAYSLKPVPVI
QHSTEANNKACAKHFERLSRAYGLLQVVNLVEQHGIEEPIGTQYRQSVSHINEQLSHGDKIPFEWFDFHQVCRGM
RFENVSHLLSQLQPRIDEFGSTTLHQGRLLHKQGGVLRTNCMDCLDRTNVCQSSFAKYMLDLQLRQAGFDMSAQV
DREAAWFNTLWADNGDAVSKQYASTAAMKGDYTRTRKRDYRGALNDLGLSLARFYNGMVNDYFSQAAIDFLLGNV
TAKVFDEFEANMMTKDPAVSMLHMRERAIQLCQKRVVADVSEEIQGAWVLISPNTANVVKSWSMDEVVLLLTDAA
LYLCRIDWDLDKVSSFERVHMANVTRLKFGTYITSTVSPAHTDETRNVGFVVEYQPGKSNVQRTNTRTLSTREEI
APKSSPTTTTEADSGPQQQPQSQSQPQQQQSPSIGSFFSTKPKSPMLRKLAFKAPYSDSSIALSTTAGGPGQTEM
QLVETICSEIERLACARQFRRDDQDDEKGMVVKEDIISLEAAKRNTGLLEQLGHSIKKLVWA*
Coding >OphauG2|4103
ATGCCCGGCCTCGCCCGCAAAATCATTGTGTGTGCAGCCATTGACGGGCTCATTATCCAGCCGCTTTCATCGCGT
GGCCAGAGACCGTTGCAGCCGGTGCGCGTCAGGTATGCAGACTCGTCCATCTCGGCAGTCCCGCGCGACCAGATT
CCAGACACGTCGACGCCGGATTCGTCCTTCGAGGCCTTTGGCGTCATAGGCCTCATTACCGTTTCAAGACTGAGT
TACCTAATCACCATTACACGGCGCCAGCAGGTTGCTCAGATCCAAGGACTCCCCGTCTACGTCGTGACAGACGTT
GCCATCACGCCCTGCACCTCGCAGTCGGATGCTGCCGAGTCTATCAAGAGAACGGCCGGCTTGCTACGACAGAGC
CTGCCCCACACCCTGAGCGACGATGGCCTGGGCAGTGATGACGAGATGGACGTCTCGCACGACATTCTCGACGAG
GCCGAGGACGACGTTTTAGCTTCGGAAGAAGACGGCATTCGCCCAGACTCGGCTCGGAGCAGCGTTGCCGAGGAT
GTTTTCCGTCGGAGGGGCAGCTATGGCAGATTCGCCCAAAGCTGGTTTGGCCGCAGCGGATGGACCTTGGAGCAG
AGACGGTCCATGGGAATGAGCATCTCGTCGAATGGCCCTGCTGCCCCTGTCGACGCCGACTCGACAGCGACACGT
CCTTTGCCACCCGACGACGACTCGACCCAGGCCCCCGCATCTACCTTGCTCCCCAAGCTTCTGCGCACAGTCAGG
GTTCTCTTTGGCTCGTCAAGAAGCTTTTACTTTTCCTATGATGTCGACCTTACCCGCAGTCTCTCCCAAGAGGCC
TTGGTCCCAGGAGCCGATGCTGCATTGCATGCCCAGGTTGACAAGACGTTTTTTTGGAATAGACACATGTTGCGT
CCCTTTACTGCTACCGGGCAAGATCCCCTGGCTCTGCCCCTGATGCTTGGATTTGTCGGACAGAGAACATTTGTC
GTGGACAGCCAACCGCCCCAGGTTAATGAGCATCCACTGGGGTCGGCGGAAATGTGCACTCTTTCTGCCGCGCCC
TCACGCTCTGGCTCTCCTCCCACTGCAAAGCCTCGTGCTTTGGCCCAACTGCGTCCTACAGAAACAGAATTGCTC
GTGACTCTGATTTCCCGCCGCTCCACCAAACGGGCTGGCTTGAGATACCTGCGGCGGGGCGTAGACGAAGATGGC
TTCGTGGCCAACATGGTTGAAACGGAGCAAATGCTCTCCTCGCCAACATGGGATCCGTCCATGCCAATCCACTCG
TTTGTGCAAATCAGGGGAAGCATTCCACTCTTTTTTACCCAGTCAGCCTACTCGCTCAAGCCCGTGCCTGTGATA
CAGCATTCAACAGAGGCCAACAATAAAGCTTGTGCAAAGCACTTTGAGCGCTTATCCAGGGCCTATGGCTTGTTG
CAGGTTGTCAATCTGGTGGAACAACACGGCATTGAGGAACCTATTGGGACACAATACCGACAAAGTGTATCACAC
ATCAACGAGCAACTGAGCCATGGCGACAAGATACCCTTTGAATGGTTCGATTTTCATCAAGTCTGCCGTGGAATG
AGGTTCGAGAATGTAAGTCACCTCTTGTCGCAGCTCCAACCAAGAATCGACGAGTTTGGGAGCACGACGCTGCAT
CAAGGCAGGCTTTTGCATAAACAAGGGGGTGTTCTCCGCACCAATTGTATGGACTGCCTCGACAGAACCAATGTC
TGCCAGAGCTCGTTTGCAAAGTACATGCTGGACCTGCAGCTCAGACAAGCCGGCTTCGACATGAGCGCGCAGGTG
GACCGAGAGGCTGCTTGGTTCAATACGCTCTGGGCAGACAATGGCGATGCCGTCTCGAAACAGTACGCGTCCACC
GCTGCCATGAAAGGCGATTATACGCGTACGAGAAAGAGAGATTATCGCGGCGCGCTCAACGACTTGGGCCTCTCC
CTGGCGCGCTTCTACAATGGCATGGTCAATGATTATTTCAGCCAGGCAGCAATAGACTTCCTTTTGGGCAATGTG
ACGGCCAAAGTCTTTGACGAGTTTGAGGCCAACATGATGACCAAAGACCCGGCCGTCTCCATGTTACATATGAGA
GAGCGGGCCATTCAGCTATGTCAAAAGAGGGTCGTGGCAGATGTAAGCGAAGAGATTCAGGGCGCCTGGGTGCTC
ATTAGCCCCAACACGGCCAATGTGGTCAAGTCATGGAGCATGGACGAGGTGGTGCTCTTGCTCACAGATGCGGCC
CTTTATCTCTGTCGCATTGACTGGGATCTGGACAAGGTGTCCTCATTTGAGCGCGTCCACATGGCCAATGTGACT
CGTCTTAAATTCGGCACATACATCACGTCGACCGTGTCTCCTGCTCACACAGATGAGACGCGCAACGTTGGCTTC
GTGGTTGAATACCAGCCGGGCAAGAGCAATGTGCAAAGAACCAATACGCGAACCTTGTCGACTCGCGAGGAGATT
GCGCCCAAGAGCAGCCCGACCACCACCACCGAGGCCGACTCTGGTCCGCAGCAGCAGCCACAATCACAGTCACAG
CCACAGCAGCAGCAGTCGCCCAGCATTGGCAGCTTCTTTTCCACCAAGCCAAAGTCGCCTATGCTCCGAAAGCTG
GCTTTCAAGGCCCCGTATTCCGACTCTTCTATTGCCTTGTCAACCACGGCAGGAGGCCCGGGGCAGACGGAGATG
CAATTGGTCGAGACGATATGCTCAGAGATTGAGCGACTGGCATGCGCGCGGCAGTTTCGCAGAGACGACCAAGAC
GACGAGAAAGGCATGGTTGTCAAGGAGGACATTATTTCGCTCGAGGCAGCCAAGCGCAACACTGGCTTGTTGGAG
CAGCTAGGCCACTCCATCAAAAAGCTGGTCTGGGCATGA
Transcript >OphauG2|4103
ATGCCCGGCCTCGCCCGCAAAATCATTGTGTGTGCAGCCATTGACGGGCTCATTATCCAGCCGCTTTCATCGCGT
GGCCAGAGACCGTTGCAGCCGGTGCGCGTCAGGTATGCAGACTCGTCCATCTCGGCAGTCCCGCGCGACCAGATT
CCAGACACGTCGACGCCGGATTCGTCCTTCGAGGCCTTTGGCGTCATAGGCCTCATTACCGTTTCAAGACTGAGT
TACCTAATCACCATTACACGGCGCCAGCAGGTTGCTCAGATCCAAGGACTCCCCGTCTACGTCGTGACAGACGTT
GCCATCACGCCCTGCACCTCGCAGTCGGATGCTGCCGAGTCTATCAAGAGAACGGCCGGCTTGCTACGACAGAGC
CTGCCCCACACCCTGAGCGACGATGGCCTGGGCAGTGATGACGAGATGGACGTCTCGCACGACATTCTCGACGAG
GCCGAGGACGACGTTTTAGCTTCGGAAGAAGACGGCATTCGCCCAGACTCGGCTCGGAGCAGCGTTGCCGAGGAT
GTTTTCCGTCGGAGGGGCAGCTATGGCAGATTCGCCCAAAGCTGGTTTGGCCGCAGCGGATGGACCTTGGAGCAG
AGACGGTCCATGGGAATGAGCATCTCGTCGAATGGCCCTGCTGCCCCTGTCGACGCCGACTCGACAGCGACACGT
CCTTTGCCACCCGACGACGACTCGACCCAGGCCCCCGCATCTACCTTGCTCCCCAAGCTTCTGCGCACAGTCAGG
GTTCTCTTTGGCTCGTCAAGAAGCTTTTACTTTTCCTATGATGTCGACCTTACCCGCAGTCTCTCCCAAGAGGCC
TTGGTCCCAGGAGCCGATGCTGCATTGCATGCCCAGGTTGACAAGACGTTTTTTTGGAATAGACACATGTTGCGT
CCCTTTACTGCTACCGGGCAAGATCCCCTGGCTCTGCCCCTGATGCTTGGATTTGTCGGACAGAGAACATTTGTC
GTGGACAGCCAACCGCCCCAGGTTAATGAGCATCCACTGGGGTCGGCGGAAATGTGCACTCTTTCTGCCGCGCCC
TCACGCTCTGGCTCTCCTCCCACTGCAAAGCCTCGTGCTTTGGCCCAACTGCGTCCTACAGAAACAGAATTGCTC
GTGACTCTGATTTCCCGCCGCTCCACCAAACGGGCTGGCTTGAGATACCTGCGGCGGGGCGTAGACGAAGATGGC
TTCGTGGCCAACATGGTTGAAACGGAGCAAATGCTCTCCTCGCCAACATGGGATCCGTCCATGCCAATCCACTCG
TTTGTGCAAATCAGGGGAAGCATTCCACTCTTTTTTACCCAGTCAGCCTACTCGCTCAAGCCCGTGCCTGTGATA
CAGCATTCAACAGAGGCCAACAATAAAGCTTGTGCAAAGCACTTTGAGCGCTTATCCAGGGCCTATGGCTTGTTG
CAGGTTGTCAATCTGGTGGAACAACACGGCATTGAGGAACCTATTGGGACACAATACCGACAAAGTGTATCACAC
ATCAACGAGCAACTGAGCCATGGCGACAAGATACCCTTTGAATGGTTCGATTTTCATCAAGTCTGCCGTGGAATG
AGGTTCGAGAATGTAAGTCACCTCTTGTCGCAGCTCCAACCAAGAATCGACGAGTTTGGGAGCACGACGCTGCAT
CAAGGCAGGCTTTTGCATAAACAAGGGGGTGTTCTCCGCACCAATTGTATGGACTGCCTCGACAGAACCAATGTC
TGCCAGAGCTCGTTTGCAAAGTACATGCTGGACCTGCAGCTCAGACAAGCCGGCTTCGACATGAGCGCGCAGGTG
GACCGAGAGGCTGCTTGGTTCAATACGCTCTGGGCAGACAATGGCGATGCCGTCTCGAAACAGTACGCGTCCACC
GCTGCCATGAAAGGCGATTATACGCGTACGAGAAAGAGAGATTATCGCGGCGCGCTCAACGACTTGGGCCTCTCC
CTGGCGCGCTTCTACAATGGCATGGTCAATGATTATTTCAGCCAGGCAGCAATAGACTTCCTTTTGGGCAATGTG
ACGGCCAAAGTCTTTGACGAGTTTGAGGCCAACATGATGACCAAAGACCCGGCCGTCTCCATGTTACATATGAGA
GAGCGGGCCATTCAGCTATGTCAAAAGAGGGTCGTGGCAGATGTAAGCGAAGAGATTCAGGGCGCCTGGGTGCTC
ATTAGCCCCAACACGGCCAATGTGGTCAAGTCATGGAGCATGGACGAGGTGGTGCTCTTGCTCACAGATGCGGCC
CTTTATCTCTGTCGCATTGACTGGGATCTGGACAAGGTGTCCTCATTTGAGCGCGTCCACATGGCCAATGTGACT
CGTCTTAAATTCGGCACATACATCACGTCGACCGTGTCTCCTGCTCACACAGATGAGACGCGCAACGTTGGCTTC
GTGGTTGAATACCAGCCGGGCAAGAGCAATGTGCAAAGAACCAATACGCGAACCTTGTCGACTCGCGAGGAGATT
GCGCCCAAGAGCAGCCCGACCACCACCACCGAGGCCGACTCTGGTCCGCAGCAGCAGCCACAATCACAGTCACAG
CCACAGCAGCAGCAGTCGCCCAGCATTGGCAGCTTCTTTTCCACCAAGCCAAAGTCGCCTATGCTCCGAAAGCTG
GCTTTCAAGGCCCCGTATTCCGACTCTTCTATTGCCTTGTCAACCACGGCAGGAGGCCCGGGGCAGACGGAGATG
CAATTGGTCGAGACGATATGCTCAGAGATTGAGCGACTGGCATGCGCGCGGCAGTTTCGCAGAGACGACCAAGAC
GACGAGAAAGGCATGGTTGTCAAGGAGGACATTATTTCGCTCGAGGCAGCCAAGCGCAACACTGGCTTGTTGGAG
CAGCTAGGCCACTCCATCAAAAAGCTGGTCTGGGCATGA
Gene >OphauG2|4103
ATGCCCGGCCTCGCCCGCAAAATCATTGTGTGTGCAGCCATTGACGGGCTCATTATCCAGCCGCTTTCATCGCGT
GGCCAGAGACCGTTGCAGCCGGTGCGCGTCAGGTATGCAGACTCGTCCATCTCGGCAGTCCCGCGCGACCAGATT
CCAGACACGTCGACGCCGGATTCGTCCTTCGAGGCCTTTGGCGTCATAGGTGTGTTGATGGCGGCTCGAGAGCTT
GTTCGCCTGTCCCCAGCTAACACGGCCATGCCAGGCCTCATTACCGTTTCAAGACTGAGTTACCTAATCACCATT
ACACGGCGCCAGCAGGTTGCTCAGATCCAAGGACTCCCCGTCTACGTCGTGACAGACGTTGCCATCACGCCCTGC
ACCTCGCAGTCGGATGCTGCCGAGTCTATCAAGAGAACGGCCGGCTTGCTACGACAGAGCCTGCCCCACACCCTG
AGCGACGATGGCCTGGGCAGTGATGACGAGATGGACGTCTCGCACGACATTCTCGACGAGGCCGAGGACGACGTT
TTAGCTTCGGAAGAAGACGGCATTCGCCCAGACTCGGCTCGGAGCAGCGTTGCCGAGGATGTTTTCCGTCGGAGG
GGCAGCTATGGCAGATTCGCCCAAAGCTGGTTTGGCCGCAGCGGATGGACCTTGGAGCAGAGACGGTCCATGGGA
ATGAGCATCTCGTCGAATGGCCCTGCTGCCCCTGTCGACGCCGACTCGACAGCGACACGTCCTTTGCCACCCGAC
GACGACTCGACCCAGGCCCCCGCATCTACCTTGCTCCCCAAGCTTCTGCGCACAGTCAGGGTTCTCTTTGGCTCG
TCAAGAAGCTTTTACTTTTCCTATGATGTCGACCTTACCCGCAGTCTCTCCCAAGAGGCCTTGGTCCCAGGAGCC
GATGCTGCATTGCATGCCCAGGTTGACAAGACGTTTTTTTGGAATAGACACATGTTGCGTCCCTTTACTGCTACC
GGGCAAGATCCCCTGGCTCTGCCCCTGATGCTTGGATTTGTCGGACAGAGAACATTTGTCGTGGACAGCCAACCG
CCCCAGGTTAATGAGCATCCACTGGGGTCGGCGGAAATGTGCACTCTTTCTGCCGCGCCCTCACGCTCTGGCTCT
CCTCCCACTGCAAAGCCTCGTGCTTTGGCCCAACTGCGTCCTACAGAAACAGAATTGCTCGTGACTCTGATTTCC
CGCCGCTCCACCAAACGGGCTGGCTTGAGATACCTGCGGCGGGGCGTAGACGAAGATGGCTTCGTGGCCAACATG
GTTGAAACGGAGCAAATGCTCTCCTCGCCAACATGGGATCCGTCCATGCCAATCCACTCGTTTGTGCAAATCAGG
GGAAGCATTCCACTCTTTTTTACCCAGTCAGCCTACTCGCTCAAGCCCGTGCCTGTGATACAGCATTCAACAGAG
GCCAACAATAAAGCTTGTGCAAAGCACTTTGAGCGCTTATCCAGGGCCTATGGCTTGTTGCAGGTTGTCAATCTG
GTGGAACAACACGGCATTGAGGAACCTATTGGGACACAATACCGACAAAGTGTATCACACATCAACGAGCAACTG
AGCCATGGCGACAAGATACCCTTTGAATGGTTCGATTTTCATCAAGTCTGCCGTGGAATGAGGTTCGAGAATGTA
AGTCACCTCTTGTCGCAGCTCCAACCAAGAATCGACGAGTTTGGGAGCACGACGCTGCATCAAGGCAGGCTTTTG
CATAAACAAGGGGGTGTTCTCCGCACCAATTGTATGGACTGCCTCGACAGAACCAATGTCTGCCAGAGCTCGTTT
GCAAAGTACATGCTGGACCTGCAGCTCAGACAAGCCGGCTTCGACATGAGCGCGCAGGTGGACCGAGAGGCTGCT
TGGTTCAATACGCTCTGGGCAGACAATGGCGATGCCGTCTCGAAACAGTACGCGTCCACCGCTGCCATGAAAGGC
GATTATACGCGTACGAGAAAGAGAGATTATCGCGGCGCGCTCAACGACTTGGGCCTCTCCCTGGCGCGCTTCTAC
AATGGGTATGTCATGGGAGGCCGTGCGCTTGCTCCTCAGTGCAGCTAATGTCGTGCAGCATGGTCAATGATTATT
TCAGCCAGGCAGCAATAGACTTCCTTTTGGGCAATGTGACGGCCAAAGTCTTTGACGAGTTTGAGGCCAACATGA
TGACCAAAGACCCGGCCGTCTCCATGTTACATATGAGAGAGCGGGCCATTCAGCTATGTCAAAAGAGGGTCGTGG
CAGATGTAAGCGAAGAGATTCAGGGCGCCTGGGTGCTCATTAGCCCCAACACGGCCAATGTGGTCAAGTCATGGA
GCATGGACGAGGTGGTGCTCTTGCTCACAGATGCGGCCCTTTATCTCTGTCGCATTGACTGGGATCTGGACAAGG
TGTCCTCATTTGAGCGCGTCCACATGGCCAATGTGACTCGTCTTAAATTCGGCACATACATCACGTCGACCGTGT
CTCCTGCTCACACAGATGAGACGCGCAACGTTGGCTTCGTGGTTGAATACCAGCCGGGCAAGAGCAATGTGCAAA
GAACCAATACGCGAACCTTGTCGACTCGCGAGGAGATTGCGCCCAAGAGCAGCCCGACCACCACCACCGAGGCCG
ACTCTGGTCCGCAGCAGCAGCCACAATCACAGTCACAGCCACAGCAGCAGCAGTCGCCCAGCATTGGCAGCTTCT
TTTCCACCAAGCCAAAGTCGCCTATGCTCCGAAAGCTGGCTTTCAAGGCCCCGTATTCCGACTCTTCTATTGCCT
TGTCAACCACGGCAGGAGGCCCGGGGCAGACGGAGATGCAATTGGTCGAGACGATATGCTCAGAGATTGAGCGAC
TGGCATGCGCGCGGCAGTTTCGCAGAGACGACCAAGACGACGAGAAAGGCATGGTTGTCAAGGAGGACATTATTT
CGCTCGAGGCAGCCAAGCGCAACACTGGCTTGTTGGAGCAGCTAGGCCACTCCATCAAAAAGCTGGTCTGGGCAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail