Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4102
Gene name
LocationContig_33:43026..44157
Strand+
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11312 Methyltransf_34 Putative SAM-dependent methyltransferase 2.5E-101 36 372

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12291|BMT6_YEAST 25S rRNA (uridine(2843)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMT6 PE=1 SV=1 30 371 1.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4102
MGNNTKPFKARAPPTSTESLSVDIEINSAQRLLNLFSAAFAPLLASDSLPALLQDIKQALFRRDFAAAFSRPDLL
DAYAARWSPPRAVCYAAVLRHVSFYLNALVSGEAPQLNAHHHDATELSISDRPGNDKLHQSDLWPTAYSANQQLT
SPNVPHKKLRMLAMGGCAAEVVAFASYLCDASLDGSLILVDSAPWSAVTSLLQTTIVSPLPLSKYASAAARAANQ
PFLSPASRLSLSFCQTDVLSLSRDALSAMTTNEPLVVTLLFTLNELYTIGGIAQTTKFLGLLGHVLAAGSLLLVI
DSPGSYSEAKVGKADKRYPMRWLLQHTLLDTKTTSHAWEKLESHDSIWCRLPAELSYPIQLEDMRYQMHLYRIRK
T*
Coding >OphauG2|4102
ATGGGCAACAACACAAAGCCATTCAAGGCCCGCGCTCCTCCCACAAGCACCGAGTCTCTGTCCGTCGACATTGAA
ATCAACTCGGCCCAGCGCCTCCTCAACCTCTTCTCCGCCGCCTTTGCGCCCCTGCTCGCCTCCGACTCCCTGCCC
GCCCTGTTACAAGACATCAAGCAGGCCCTCTTCCGCCGCGACTTTGCCGCCGCTTTTTCGCGCCCCGACCTGCTC
GATGCATATGCCGCGCGCTGGAGTCCGCCTCGCGCCGTTTGCTATGCTGCTGTGCTGCGCCATGTTTCCTTCTAC
CTCAATGCCCTAGTCTCTGGCGAAGCGCCGCAGCTCAATGCGCATCATCATGACGCAACAGAGCTTAGCATCAGT
GACCGGCCTGGAAATGACAAGCTTCACCAAAGCGACCTCTGGCCAACGGCTTATAGCGCCAATCAACAACTCACA
TCTCCCAATGTCCCTCACAAGAAGCTCCGCATGCTTGCCATGGGCGGCTGCGCGGCAGAAGTCGTCGCTTTCGCC
TCGTATCTTTGCGATGCCTCTCTAGACGGCTCTCTCATACTCGTCGACTCCGCACCATGGTCCGCAGTTACAAGC
CTCCTCCAAACCACCATTGTGTCGCCTCTCCCGCTTTCCAAGTATGCCTCGGCCGCCGCCCGAGCTGCCAACCAG
CCATTTTTATCACCAGCTTCGCGTCTCTCCCTCTCCTTTTGTCAAACCGACGTGCTCTCTCTATCACGCGACGCT
CTTTCCGCCATGACTACAAACGAACCCCTTGTAGTAACTCTGCTCTTTACCCTCAATGAGCTGTATACCATTGGT
GGCATCGCACAGACGACAAAGTTCCTTGGTCTTCTTGGTCATGTCCTTGCTGCGGGTAGCTTGCTCCTCGTTATT
GACAGCCCTGGCAGCTACTCAGAGGCCAAAGTCGGCAAGGCGGACAAGCGCTACCCTATGCGATGGCTGCTTCAA
CACACGCTGCTCGACACAAAGACGACATCCCATGCCTGGGAGAAGCTCGAGTCACACGATTCCATCTGGTGTCGC
CTACCCGCCGAGCTTTCTTATCCCATTCAACTCGAGGACATGCGATACCAGATGCACCTATACCGAATACGCAAG
ACTTAG
Transcript >OphauG2|4102
ATGGGCAACAACACAAAGCCATTCAAGGCCCGCGCTCCTCCCACAAGCACCGAGTCTCTGTCCGTCGACATTGAA
ATCAACTCGGCCCAGCGCCTCCTCAACCTCTTCTCCGCCGCCTTTGCGCCCCTGCTCGCCTCCGACTCCCTGCCC
GCCCTGTTACAAGACATCAAGCAGGCCCTCTTCCGCCGCGACTTTGCCGCCGCTTTTTCGCGCCCCGACCTGCTC
GATGCATATGCCGCGCGCTGGAGTCCGCCTCGCGCCGTTTGCTATGCTGCTGTGCTGCGCCATGTTTCCTTCTAC
CTCAATGCCCTAGTCTCTGGCGAAGCGCCGCAGCTCAATGCGCATCATCATGACGCAACAGAGCTTAGCATCAGT
GACCGGCCTGGAAATGACAAGCTTCACCAAAGCGACCTCTGGCCAACGGCTTATAGCGCCAATCAACAACTCACA
TCTCCCAATGTCCCTCACAAGAAGCTCCGCATGCTTGCCATGGGCGGCTGCGCGGCAGAAGTCGTCGCTTTCGCC
TCGTATCTTTGCGATGCCTCTCTAGACGGCTCTCTCATACTCGTCGACTCCGCACCATGGTCCGCAGTTACAAGC
CTCCTCCAAACCACCATTGTGTCGCCTCTCCCGCTTTCCAAGTATGCCTCGGCCGCCGCCCGAGCTGCCAACCAG
CCATTTTTATCACCAGCTTCGCGTCTCTCCCTCTCCTTTTGTCAAACCGACGTGCTCTCTCTATCACGCGACGCT
CTTTCCGCCATGACTACAAACGAACCCCTTGTAGTAACTCTGCTCTTTACCCTCAATGAGCTGTATACCATTGGT
GGCATCGCACAGACGACAAAGTTCCTTGGTCTTCTTGGTCATGTCCTTGCTGCGGGTAGCTTGCTCCTCGTTATT
GACAGCCCTGGCAGCTACTCAGAGGCCAAAGTCGGCAAGGCGGACAAGCGCTACCCTATGCGATGGCTGCTTCAA
CACACGCTGCTCGACACAAAGACGACATCCCATGCCTGGGAGAAGCTCGAGTCACACGATTCCATCTGGTGTCGC
CTACCCGCCGAGCTTTCTTATCCCATTCAACTCGAGGACATGCGATACCAGATGCACCTATACCGAATACGCAAG
ACTTAG
Gene >OphauG2|4102
ATGGGCAACAACACAAAGCCATTCAAGGCCCGCGCTCCTCCCACAAGCACCGAGTCTCTGTCCGTCGACATTGAA
ATCAACTCGGCCCAGCGCCTCCTCAACCTCTTCTCCGCCGCCTTTGCGCCCCTGCTCGCCTCCGACTCCCTGCCC
GCCCTGTTACAAGACATCAAGCAGGCCCTCTTCCGCCGCGACTTTGCCGCCGCTTTTTCGCGCCCCGACCTGCTC
GATGCATATGCCGCGCGCTGGAGTCCGCCTCGCGCCGTTTGCTATGCTGCTGTGCTGCGCCATGTTTCCTTCTAC
CTCAATGCCCTAGTCTCTGGCGAAGCGCCGCAGCTCAATGCGCATCATCATGACGCAACAGAGCTTAGCATCAGT
GACCGGCCTGGAAATGACAAGCTTCACCAAAGCGACCTCTGGCCAACGGCTTATAGCGCCAATCAACAACTCACA
TCTCCCAATGTCCCTCACAAGAAGCTCCGCATGCTTGCCATGGGCGGCTGCGCGGCAGAAGTCGTCGCTTTCGCC
TCGTATCTTTGCGATGCCTCTCTAGACGGCTCTCTCATACTCGTCGACTCCGCACCATGGTCCGCAGTTACAAGC
CTCCTCCAAACCACCATTGTGTCGCCTCTCCCGCTTTCCAAGTATGCCTCGGCCGCCGCCCGAGCTGCCAACCAG
CCATTTTTATCACCAGCTTCGCGTCTCTCCCTCTCCTTTTGTCAAACCGACGTGCTCTCTCTATCACGCGACGCT
CTTTCCGCCATGACTACAAACGAACCCCTTGTAGTAACTCTGCTCTTTACCCTCAATGAGCTGTATACCATTGGT
GGCATCGCACAGACGACAAAGTTCCTTGGTCTTCTTGGTCATGTCCTTGCTGCGGGTAGCTTGCTCCTCGTTATT
GACAGCCCTGGCAGCTACTCAGAGGCCAAAGTCGGCAAGGCGGACAAGCGCTACCCTATGCGATGGCTGCTTCAA
CACACGCTGCTCGACACAAAGACGACATCCCATGCCTGGGAGAAGCTCGAGTCACACGATTCCATCTGGTGTCGC
CTACCCGCCGAGCTTTCTTATCCCATTCAACTCGAGGACATGCGATACCAGATGCACCTATACCGAATACGCAAG
ACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail