Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4088
Gene name
LocationContig_33:4889..8462
Strand-
Gene length (bp)3573
Transcript length (bp)2793
Coding sequence length (bp)2793
Protein length (aa) 931

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16158 N_BRCA1_IG Ig-like domain from next to BRCA1 gene 2.9E-34 706 818
PF00569 ZZ Zinc finger, ZZ type 9.8E-08 480 518

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P792|YN8B_SCHPO ZZ-type zinc finger-containing protein P35G2.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.11c PE=3 SV=1 360 582 4.0E-18
sp|Q501R9|NBR1_RAT Next to BRCA1 gene 1 protein OS=Rattus norvegicus GN=Nbr1 PE=1 SV=1 559 818 2.0E-15
sp|Q14596|NBR1_HUMAN Next to BRCA1 gene 1 protein OS=Homo sapiens GN=NBR1 PE=1 SV=3 559 818 5.0E-15
sp|P97432|NBR1_MOUSE Next to BRCA1 gene 1 protein OS=Mus musculus GN=Nbr1 PE=1 SV=1 559 818 8.0E-14
sp|Q5RC94|NBR1_PONAB Next to BRCA1 gene 1 protein OS=Pongo abelii GN=NBR1 PE=2 SV=1 559 818 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P792|YN8B_SCHPO ZZ-type zinc finger-containing protein P35G2.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.11c PE=3 SV=1 360 582 4.0E-18
sp|Q501R9|NBR1_RAT Next to BRCA1 gene 1 protein OS=Rattus norvegicus GN=Nbr1 PE=1 SV=1 559 818 2.0E-15
sp|Q14596|NBR1_HUMAN Next to BRCA1 gene 1 protein OS=Homo sapiens GN=NBR1 PE=1 SV=3 559 818 5.0E-15
sp|P97432|NBR1_MOUSE Next to BRCA1 gene 1 protein OS=Mus musculus GN=Nbr1 PE=1 SV=1 559 818 8.0E-14
sp|Q5RC94|NBR1_PONAB Next to BRCA1 gene 1 protein OS=Pongo abelii GN=NBR1 PE=2 SV=1 559 818 1.0E-13
sp|Q3TT38|CF106_MOUSE Uncharacterized protein C6orf106 homolog OS=Mus musculus GN=D17Wsu92e PE=2 SV=2 701 822 1.0E-10
sp|Q9H6K1|CF106_HUMAN Uncharacterized protein C6orf106 OS=Homo sapiens GN=C6orf106 PE=1 SV=2 701 822 1.0E-10
sp|Q5BL31|CF106_DANRE Uncharacterized protein C6orf106 homolog OS=Danio rerio GN=zgc:101577 PE=2 SV=1 701 818 3.0E-09
sp|Q5F3N9|CF106_CHICK Uncharacterized protein C6orf106 homolog OS=Gallus gallus GN=RCJMB04_11e11 PE=2 SV=1 701 822 3.0E-09
sp|O43149|ZZEF1_HUMAN Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ZZEF1 PE=1 SV=6 484 605 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4088
MALFRFGDTRPLLGLGPPVPPAILWFLVPFLHQRMASLPTSGLDAPINLKVIYDGATRRAKMPLREMAPKLLEEQ
VRAFLHISDDTKIMIERYSDSASAYVMLDSSNLSVYKQLFRAAKAKSKLKLRVSALRGEAPTSGARFVAPVKPSP
KQVPLEPLPKPETPPMAEKPMASQPQNTPSDSNEMERKASEEAFPATVSAPTPAAASEISLPFRCSGPATVSSPT
RITGPNPSFQTYLKENKDLLLRLDRLGKGPGPDTKATQPPIVPDQTETKYQAPRNVEQFNKPTKAAVGCGFAVCC
NGCQKNISDVHFHCSTCDDGDFDLCPACLDKGATCYVADHWLIRRVIHGGQIVHSTSMILPTKPKLKASVLSAKA
EIERTIEQRVKAEEVKPRLTPQNPASWERPSIRSCQRTCNCCVKVLPEKQFLHCTSCKDYDVCLPCFVVGQHGHH
PNHEFVQVSNSITVPETVKPKMAPGRGQAHHAICDGCDEYIVGVRNKCLDCPDWDFCSSCMVNASASHPGHRFVP
IYEPLEQVKLTQDDMAVHYGICCDGPLCSSNQACPAYIMGIRYKCAVCHDLDYCASCEASPLNDHNATHPLIKFK
TPIRHVNVTTTGEHPDGKRMPVMGDRSPSPPPKIIEAPMSPPVNNSINVAQTVMDVKPTESLSATEQSEKLNIST
PAPRSEVKPALITQASLIEANLEAEFVRDSIRDGTIMPPNQDFEQTWVLRNSGDYDWPAGCRIRFVGGDYMGLAD
SAHPASMSELASASESSICQAVIEPGEEYSFTCRLRTPARSGKIVSYWRLTTESGIKFGHRLWCEVNVHVAAGAP
AKPSHALNATDKVALEECPKTTVGAMIFPKLDGGSETLSPQPKSVDDADGTSSKTCTAGEAEFDDCSQDDEWDES
EEFLTDEEYDILDASDEEFLEEHQKQVGKQ*
Coding >OphauG2|4088
ATGGCACTTTTTCGCTTTGGGGATACCCGCCCGCTCCTTGGCCTGGGGCCGCCGGTGCCTCCAGCTATTTTGTGG
TTTCTAGTGCCATTTCTGCACCAGAGAATGGCTTCTCTCCCAACATCTGGGCTCGACGCCCCCATTAATCTCAAG
GTCATTTACGATGGAGCTACACGTCGTGCCAAAATGCCACTCCGCGAGATGGCACCCAAGCTACTTGAAGAACAG
GTCCGAGCTTTTCTTCACATCTCTGATGATACCAAAATCATGATTGAACGCTACTCCGACTCGGCTTCGGCTTAC
GTCATGCTTGATTCGTCCAACCTATCAGTCTATAAGCAGCTCTTTCGAGCTGCAAAGGCAAAGTCGAAGCTTAAG
CTGCGCGTCTCAGCCCTAAGAGGTGAGGCACCGACTTCGGGTGCACGCTTCGTCGCCCCAGTCAAGCCATCGCCC
AAGCAGGTGCCGCTCGAACCACTGCCAAAGCCTGAAACCCCGCCCATGGCTGAAAAGCCCATGGCCAGCCAGCCT
CAGAATACTCCCTCTGACTCAAACGAGATGGAACGAAAGGCTTCTGAAGAAGCTTTCCCGGCCACTGTCTCGGCT
CCCACGCCGGCTGCAGCATCTGAAATATCTCTTCCATTTCGCTGCTCTGGCCCCGCTACAGTCTCGAGCCCCACC
CGCATCACTGGTCCGAATCCTTCATTCCAGACCTATCTCAAGGAGAATAAAGACTTGCTGCTGCGTTTGGATCGC
CTGGGCAAGGGGCCTGGCCCAGACACAAAGGCCACGCAGCCTCCCATTGTCCCGGATCAAACTGAAACCAAGTAC
CAGGCGCCACGCAACGTTGAGCAGTTCAACAAGCCTACAAAAGCTGCCGTTGGTTGTGGCTTTGCCGTGTGCTGC
AACGGATGCCAGAAGAATATTTCCGACGTTCATTTTCACTGCTCCACTTGCGATGATGGAGACTTTGATTTGTGT
CCCGCCTGCCTTGACAAGGGCGCCACTTGCTATGTCGCCGATCACTGGCTGATTAGGCGCGTCATTCACGGCGGT
CAAATCGTTCACAGTACCTCCATGATTCTTCCTACGAAGCCAAAGCTGAAGGCTTCTGTGCTGTCTGCCAAAGCC
GAAATTGAGCGGACTATTGAGCAGAGAGTGAAAGCCGAGGAGGTCAAGCCACGCTTGACTCCTCAAAATCCTGCC
AGCTGGGAACGTCCCAGTATCCGCAGCTGCCAACGGACCTGCAACTGCTGCGTCAAAGTGCTTCCCGAAAAGCAA
TTCCTGCACTGCACCTCTTGCAAGGACTACGACGTCTGCCTACCGTGCTTCGTAGTGGGCCAACATGGCCATCAC
CCAAACCATGAATTCGTTCAGGTGTCCAACAGCATTACAGTGCCAGAGACTGTCAAGCCCAAGATGGCTCCTGGT
CGCGGACAGGCCCACCACGCCATCTGTGACGGCTGTGACGAGTACATTGTTGGTGTTCGAAACAAGTGCCTTGAC
TGTCCTGACTGGGACTTCTGCTCATCATGCATGGTGAATGCTTCGGCATCTCACCCAGGCCATCGTTTTGTGCCC
ATTTACGAGCCTCTGGAACAAGTCAAGCTTACCCAGGATGACATGGCAGTTCATTATGGCATTTGCTGCGATGGA
CCACTTTGTTCGTCCAACCAGGCTTGCCCGGCGTATATTATGGGCATTCGCTACAAGTGCGCTGTGTGCCATGAC
CTCGACTATTGTGCCTCTTGCGAGGCCAGCCCACTCAACGATCATAACGCTACCCATCCTTTGATCAAGTTCAAG
ACACCGATCCGTCATGTCAATGTGACTACGACTGGTGAGCACCCTGATGGCAAGCGTATGCCAGTCATGGGGGAC
CGTAGTCCCAGCCCTCCGCCGAAAATAATCGAGGCGCCCATGTCGCCACCAGTCAACAACTCAATCAACGTGGCG
CAGACCGTCATGGACGTGAAGCCCACGGAATCTTTGTCGGCAACTGAGCAATCTGAAAAGCTAAACATTTCAACC
CCTGCGCCTCGGTCTGAAGTCAAGCCTGCTTTGATTACGCAAGCATCGCTTATTGAAGCGAATCTCGAAGCTGAA
TTTGTTCGAGATTCGATACGTGACGGCACTATTATGCCACCAAACCAAGACTTTGAACAGACTTGGGTCCTTCGC
AACTCGGGCGACTATGACTGGCCGGCTGGATGCCGTATCAGATTTGTTGGAGGCGACTACATGGGACTTGCCGAC
TCTGCTCATCCTGCCAGCATGTCAGAGCTGGCTTCGGCTTCCGAGTCGAGTATCTGCCAGGCTGTCATTGAACCC
GGTGAAGAATACAGCTTCACGTGCCGTCTTCGCACACCTGCTCGGTCTGGCAAGATTGTTTCATACTGGCGTCTG
ACGACGGAATCTGGAATCAAGTTTGGTCACCGTCTCTGGTGCGAGGTCAATGTCCATGTGGCGGCTGGCGCCCCA
GCCAAGCCATCGCATGCTTTGAACGCTACAGACAAGGTTGCTTTGGAGGAATGCCCAAAGACGACGGTCGGTGCA
ATGATATTTCCCAAGTTGGACGGCGGGTCTGAGACACTGTCTCCCCAGCCAAAGAGCGTCGATGATGCAGATGGC
ACGTCGAGCAAGACTTGCACTGCCGGGGAAGCCGAGTTTGATGATTGCAGTCAGGACGATGAGTGGGATGAATCT
GAGGAGTTCTTGACGGATGAAGAATACGACATTCTGGACGCCTCGGATGAAGAATTCCTCGAGGAGCACCAGAAG
CAGGTTGGCAAGCAGTAA
Transcript >OphauG2|4088
ATGGCACTTTTTCGCTTTGGGGATACCCGCCCGCTCCTTGGCCTGGGGCCGCCGGTGCCTCCAGCTATTTTGTGG
TTTCTAGTGCCATTTCTGCACCAGAGAATGGCTTCTCTCCCAACATCTGGGCTCGACGCCCCCATTAATCTCAAG
GTCATTTACGATGGAGCTACACGTCGTGCCAAAATGCCACTCCGCGAGATGGCACCCAAGCTACTTGAAGAACAG
GTCCGAGCTTTTCTTCACATCTCTGATGATACCAAAATCATGATTGAACGCTACTCCGACTCGGCTTCGGCTTAC
GTCATGCTTGATTCGTCCAACCTATCAGTCTATAAGCAGCTCTTTCGAGCTGCAAAGGCAAAGTCGAAGCTTAAG
CTGCGCGTCTCAGCCCTAAGAGGTGAGGCACCGACTTCGGGTGCACGCTTCGTCGCCCCAGTCAAGCCATCGCCC
AAGCAGGTGCCGCTCGAACCACTGCCAAAGCCTGAAACCCCGCCCATGGCTGAAAAGCCCATGGCCAGCCAGCCT
CAGAATACTCCCTCTGACTCAAACGAGATGGAACGAAAGGCTTCTGAAGAAGCTTTCCCGGCCACTGTCTCGGCT
CCCACGCCGGCTGCAGCATCTGAAATATCTCTTCCATTTCGCTGCTCTGGCCCCGCTACAGTCTCGAGCCCCACC
CGCATCACTGGTCCGAATCCTTCATTCCAGACCTATCTCAAGGAGAATAAAGACTTGCTGCTGCGTTTGGATCGC
CTGGGCAAGGGGCCTGGCCCAGACACAAAGGCCACGCAGCCTCCCATTGTCCCGGATCAAACTGAAACCAAGTAC
CAGGCGCCACGCAACGTTGAGCAGTTCAACAAGCCTACAAAAGCTGCCGTTGGTTGTGGCTTTGCCGTGTGCTGC
AACGGATGCCAGAAGAATATTTCCGACGTTCATTTTCACTGCTCCACTTGCGATGATGGAGACTTTGATTTGTGT
CCCGCCTGCCTTGACAAGGGCGCCACTTGCTATGTCGCCGATCACTGGCTGATTAGGCGCGTCATTCACGGCGGT
CAAATCGTTCACAGTACCTCCATGATTCTTCCTACGAAGCCAAAGCTGAAGGCTTCTGTGCTGTCTGCCAAAGCC
GAAATTGAGCGGACTATTGAGCAGAGAGTGAAAGCCGAGGAGGTCAAGCCACGCTTGACTCCTCAAAATCCTGCC
AGCTGGGAACGTCCCAGTATCCGCAGCTGCCAACGGACCTGCAACTGCTGCGTCAAAGTGCTTCCCGAAAAGCAA
TTCCTGCACTGCACCTCTTGCAAGGACTACGACGTCTGCCTACCGTGCTTCGTAGTGGGCCAACATGGCCATCAC
CCAAACCATGAATTCGTTCAGGTGTCCAACAGCATTACAGTGCCAGAGACTGTCAAGCCCAAGATGGCTCCTGGT
CGCGGACAGGCCCACCACGCCATCTGTGACGGCTGTGACGAGTACATTGTTGGTGTTCGAAACAAGTGCCTTGAC
TGTCCTGACTGGGACTTCTGCTCATCATGCATGGTGAATGCTTCGGCATCTCACCCAGGCCATCGTTTTGTGCCC
ATTTACGAGCCTCTGGAACAAGTCAAGCTTACCCAGGATGACATGGCAGTTCATTATGGCATTTGCTGCGATGGA
CCACTTTGTTCGTCCAACCAGGCTTGCCCGGCGTATATTATGGGCATTCGCTACAAGTGCGCTGTGTGCCATGAC
CTCGACTATTGTGCCTCTTGCGAGGCCAGCCCACTCAACGATCATAACGCTACCCATCCTTTGATCAAGTTCAAG
ACACCGATCCGTCATGTCAATGTGACTACGACTGGTGAGCACCCTGATGGCAAGCGTATGCCAGTCATGGGGGAC
CGTAGTCCCAGCCCTCCGCCGAAAATAATCGAGGCGCCCATGTCGCCACCAGTCAACAACTCAATCAACGTGGCG
CAGACCGTCATGGACGTGAAGCCCACGGAATCTTTGTCGGCAACTGAGCAATCTGAAAAGCTAAACATTTCAACC
CCTGCGCCTCGGTCTGAAGTCAAGCCTGCTTTGATTACGCAAGCATCGCTTATTGAAGCGAATCTCGAAGCTGAA
TTTGTTCGAGATTCGATACGTGACGGCACTATTATGCCACCAAACCAAGACTTTGAACAGACTTGGGTCCTTCGC
AACTCGGGCGACTATGACTGGCCGGCTGGATGCCGTATCAGATTTGTTGGAGGCGACTACATGGGACTTGCCGAC
TCTGCTCATCCTGCCAGCATGTCAGAGCTGGCTTCGGCTTCCGAGTCGAGTATCTGCCAGGCTGTCATTGAACCC
GGTGAAGAATACAGCTTCACGTGCCGTCTTCGCACACCTGCTCGGTCTGGCAAGATTGTTTCATACTGGCGTCTG
ACGACGGAATCTGGAATCAAGTTTGGTCACCGTCTCTGGTGCGAGGTCAATGTCCATGTGGCGGCTGGCGCCCCA
GCCAAGCCATCGCATGCTTTGAACGCTACAGACAAGGTTGCTTTGGAGGAATGCCCAAAGACGACGGTCGGTGCA
ATGATATTTCCCAAGTTGGACGGCGGGTCTGAGACACTGTCTCCCCAGCCAAAGAGCGTCGATGATGCAGATGGC
ACGTCGAGCAAGACTTGCACTGCCGGGGAAGCCGAGTTTGATGATTGCAGTCAGGACGATGAGTGGGATGAATCT
GAGGAGTTCTTGACGGATGAAGAATACGACATTCTGGACGCCTCGGATGAAGAATTCCTCGAGGAGCACCAGAAG
CAGGTTGGCAAGCAGTAA
Gene >OphauG2|4088
ATGGCACTTTTTCGCTTTGGGGATACCCGCCCGCTCCTTGGCCTGGGGGTGGGGCTCCCGCCCAGGCCATCGACT
GGGCATCGCAGGCCTAAAAGCCTGTAGAATAGTGGCCCCGCTTCTTGTCTGCTTGCCCGTCGTCTCTCCACTCCC
CGAAACCTAGATCCATCCATCCATCCTCCTCCCCCCTTCTCACCATCTCCATCATCACCGCCATCCACCACCTTC
ATCATTCATCCCTCTTCGCACCGCCCCGACTCTTGTTGCCTTGTGTCATTGCCCCGGCTGCTTGTGCACCACTCT
GGTCGTCTGCCAGCGTCCCCCAAGCCAGCAGAGAGCCTCAGCCGTGACCAGTGCACAAGCTGACCGCCTCATTCG
TCAGCCGCCGGTGCCTCCAGCGTGAGTTGCAATGCACCCTTTTCGCACCTCTCTGCCGAGCGTCACCCTCCAATA
AACTGGCAATGGCTAACGCGTTTTTGTGAGTCGACAGTATTTTGTGGTTTCTAGTGCCATTTCTGCACCAGAGAA
TGGCTTCTCTCCCAACATCTGGGCTCGACGCCCCCATTAATCTCAAGGTCATTTACGATGGAGCTACACGTCGTG
CCAAAATGCCACTCCGCGAGATGGCACCCAAGCTACTTGAAGAACAGGTAGGCCTCCATTTTCCCTCTATTGACT
CTTCTTTTTTTGTTTTTTTTTGGGGGTCTTTTCCACCAAAAATATGTGGGCTATACGTACCAACCTGCCACCTGG
CACGCCTCGACCCAAAAGAAAGCTATAATACAAAGCTATGGCTCACAGCTGCTAACGCTTGTCCGCCAGGTCCGA
GCTTTTCTTCACATCTCTGATGATACCAAAATCATGATTGAACGCTACTCCGACTCGGCTTCGGCTTACGTCATG
CTTGATTCGTCCAACCTATCAGTCTATAAGCAGCTCTTTCGAGCTGCAAAGGCAAAGTCGAAGCTTAAGCTGCGC
GTCTCAGCCCTAAGAGGTGAGGCACCGACTTCGGGTGCACGCTTCGTCGCCCCAGTCAAGCCATCGCCCAAGCAG
GTGCCGCTCGAACCACTGCCAAAGCCTGAAACCCCGCCCATGGCTGAAAAGCCCATGGCCAGCCAGCCTCAGAAT
ACTCCCTCTGACTCAAACGAGATGGAACGAAAGGCTTCTGAAGAAGCTTTCCCGGCCACTGTCTCGGCTCCCACG
CCGGCTGCAGCATCTGAAATATCTCTTCCATTTCGCTGCTCTGGCCCCGCTACAGTCTCGAGCCCCACCCGCATC
ACTGGTCCGAATCCTTCATTCCAGACCTATCTCAAGGAGAATAAAGACTTGCTGCTGCGTTTGGATCGCCTGGGC
AAGGGGCCTGGCCCAGACACAAAGGCCACGCAGCCTCCCATTGTCCCGGATCAAACTGAAACCAAGTACCAGGCG
CCACGCAACGTTGAGCAGTTCAACAAGCCTACAAAAGCTGCCGTTGGTTGTGGCTTTGCCGTGTGCTGCAACGGA
TGCCAGAAGAATATTTCCGACGTTCATTTTCACTGCTCCACTTGCGATGATGGAGACTTTGATTTGTGTCCCGCC
TGCCTTGACAAGGGCGCCACTTGCTATGTCGCCGATCACTGGCTGATTAGGCGCGTCATTCACGGCGGTCAAATC
GTTCACAGTACCTCCATGATTCTTCCTACGAAGCCAAAGCTGAAGGCTTCTGTGCTGTCTGCCAAAGCCGAAATT
GAGCGGACTATTGAGCAGAGAGTGAAAGCCGAGGAGGTCAAGGTAGCTGCTGAAACCCTTACGGCGAAAATTCGA
GGTTCTCTTTGTGATGTCCGTACCAATAACCAGCCACGCTTGACTCCTCAAAATCCTGCCAGCTGGGAACGTCCC
AGTATCCGCAGCTGCCAACGGACCTGCAACTGCTGCGTCAAAGGTTTGTGTCCCATTGCCTGCTCACCGTCCAAC
AAGAGCCATGATTATCTAATAAACTCTCATCTTTAGTGCTTCCCGAAAAGCAATTCCTGCACTGCACCTCTTGCA
AGGACTACGACGTCTGCCTACCGTGCTTCGTAGTGGGCCAACATGGCCATCACCCAAACCATGAATTCGTTCAGG
TGTCCAACAGCATTACAGTGCCAGAGACTGTCAAGCCCAAGATGGCTCCTGGTCGCGGACAGGCCCACCACGCCA
TCTGTGACGGCTGTGACGAGGTCAGTAATGCGTGCATGCTGTGGGAAATCTTGCTTCTGACATGGCTTCTAGTAC
ATTGTTGGTGTTCGAAACAAGTGCCTTGACTGTCCTGACTGGGACTTCTGCTCATCATGCATGGTGAATGCTTCG
GCATCTCACCCAGGCCATCGTTTTGTGCCCATTTACGAGCCTCTGGAACAAGTCAAGCTTACCCAGGATGACATG
GCAGTTCATTATGGCATTTGCTGCGATGGACCACTTTGTTCGTCCAACCAGGCTTGCCCGGCGTATATTATGGGC
ATTCGCTACAAGTGCGCTGTGTGCCATGACCTCGACTATTGTGCCTCTTGCGAGGCCAGCCCACTCAACGATCAT
AACGCTACCCATCCTTTGATCAAGTTCAAGACACCGATCCGTCATGTCAATGTGACTACGACTGGTGAGCACCCT
GATGGCAAGCGTATGCCAGTCATGGGGGACCGTAGTCCCAGCCCTCCGCCGAAAATAATCGAGGCGCCCATGTCG
CCACCAGTCAACAACTCAATCAACGTGGCGCAGACCGTCATGGACGTGAAGCCCACGGAATCTTTGTCGGCAACT
GAGCAATCTGAAAAGCTAAACATTTCAACCCCTGCGCCTCGGTCTGAAGTCAAGCCTGCTTTGATTACGCAAGCA
TCGCTTATTGAAGCGAATCTCGAAGCTGAATTTGTTCGAGATTCGATACGTGACGGCACTATTATGCCACCAAAC
CAAGACTTTGAACAGACTTGGGTCCTTCGCAACTCGGGCGACTATGACTGGCCGGCTGGATGCCGTATCAGATTT
GTTGGAGGCGACTACATGGGACTTGCCGACTCTGCTCATCCTGCCAGCATGTCAGAGCTGGCTTCGGCTTCCGAG
TCGAGTATCTGCCAGGCTGTCATTGAACCCGGTGAAGAATACAGCTTCACGTGCCGTCTTCGCACACCTGCTCGG
TCTGGCAAGATTGTTTCATACTGGCGTCTGACGACGGAATCTGGAATCAAGTTTGGTCACCGTCTCTGGTGCGAG
GTCAATGTCCATGTGGCGGCTGGCGCCCCAGCCAAGCCATCGCATGCTTTGAACGCTACAGACAAGGTTGCTTTG
GAGGAATGCCCAAAGACGACGGTCGGTGCAATGATATTTCCCAAGTTGGACGGCGGGTCTGAGACACTGTCTCCC
CAGCCAAAGAGCGTCGATGATGCAGATGGCACGTCGAGCAAGACTTGCACTGCCGGGGAAGCCGAGTTTGATGAT
TGCAGTCAGGACGATGAGTGGGATGAATCTGAGGAGTTCTTGACGGATGAAGAATACGACATTCTGGACGCCTCG
GATGAAGAATTCCTCGAGGAGCACCAGAAGCAGGTTGGCAAGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail