Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4081
Gene name
LocationContig_329:7760..8712
Strand-
Gene length (bp)952
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02115 Rho_GDI RHO protein GDP dissociation inhibitor 9.7E-63 9 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14224|GDIR_SCHPO Rho GDP-dissociation inhibitor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F12.06 PE=1 SV=1 2 198 6.0E-53
sp|Q12434|GDIR_YEAST Rho GDP-dissociation inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDI1 PE=1 SV=1 16 196 2.0E-39
sp|Q9TU03|GDIR2_BOVIN Rho GDP-dissociation inhibitor 2 OS=Bos taurus GN=ARHGDIB PE=2 SV=3 21 198 7.0E-39
sp|Q61599|GDIR2_MOUSE Rho GDP-dissociation inhibitor 2 OS=Mus musculus GN=Arhgdib PE=1 SV=3 21 198 2.0E-38
sp|P52566|GDIR2_HUMAN Rho GDP-dissociation inhibitor 2 OS=Homo sapiens GN=ARHGDIB PE=1 SV=3 21 198 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14224|GDIR_SCHPO Rho GDP-dissociation inhibitor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F12.06 PE=1 SV=1 2 198 6.0E-53
sp|Q12434|GDIR_YEAST Rho GDP-dissociation inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDI1 PE=1 SV=1 16 196 2.0E-39
sp|Q9TU03|GDIR2_BOVIN Rho GDP-dissociation inhibitor 2 OS=Bos taurus GN=ARHGDIB PE=2 SV=3 21 198 7.0E-39
sp|Q61599|GDIR2_MOUSE Rho GDP-dissociation inhibitor 2 OS=Mus musculus GN=Arhgdib PE=1 SV=3 21 198 2.0E-38
sp|P52566|GDIR2_HUMAN Rho GDP-dissociation inhibitor 2 OS=Homo sapiens GN=ARHGDIB PE=1 SV=3 21 198 1.0E-37
sp|Q95UQ1|GDIR1_DICDI Putative rho GDP-dissociation inhibitor 1 OS=Dictyostelium discoideum GN=rdiA PE=1 SV=1 24 198 3.0E-36
sp|Q4R4J0|GDIR1_MACFA Rho GDP-dissociation inhibitor 1 OS=Macaca fascicularis GN=ARHGDIA PE=2 SV=1 1 198 1.0E-34
sp|P52565|GDIR1_HUMAN Rho GDP-dissociation inhibitor 1 OS=Homo sapiens GN=ARHGDIA PE=1 SV=3 1 198 1.0E-34
sp|Q5XI73|GDIR1_RAT Rho GDP-dissociation inhibitor 1 OS=Rattus norvegicus GN=Arhgdia PE=1 SV=1 1 198 2.0E-34
sp|Q99PT1|GDIR1_MOUSE Rho GDP-dissociation inhibitor 1 OS=Mus musculus GN=Arhgdia PE=1 SV=3 1 198 2.0E-34
sp|P19803|GDIR1_BOVIN Rho GDP-dissociation inhibitor 1 OS=Bos taurus GN=ARHGDIA PE=1 SV=3 1 198 6.0E-34
sp|Q9SFC6|GDIR_ARATH Rho GDP-dissociation inhibitor 1 OS=Arabidopsis thaliana GN=GDI1 PE=1 SV=1 21 198 9.0E-32
sp|Q20496|GDIR_CAEEL Probable rho GDP-dissociation inhibitor OS=Caenorhabditis elegans GN=rhi-1 PE=3 SV=1 11 197 2.0E-31
sp|Q99819|GDIR3_HUMAN Rho GDP-dissociation inhibitor 3 OS=Homo sapiens GN=ARHGDIG PE=1 SV=2 22 198 2.0E-30
sp|Q62160|GDIR3_MOUSE Rho GDP-dissociation inhibitor 3 OS=Mus musculus GN=Arhgdig PE=2 SV=1 22 198 5.0E-29
sp|Q0II80|GDIR3_BOVIN Rho GDP-dissociation inhibitor 3 OS=Bos taurus GN=ARHGDIG PE=2 SV=1 22 198 7.0E-29
sp|P80237|GDIR1_CAVPO Rho GDP-dissociation inhibitor 1 (Fragments) OS=Cavia porcellus GN=ARHGDIA PE=1 SV=1 119 196 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0005094 Rho GDP-dissociation inhibitor activity Yes
GO:0003674 molecular_function No
GO:0005092 GDP-dissociation inhibitor activity No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No
GO:0030695 GTPase regulator activity No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4081 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5908
Ophiocordyceps camponoti-floridani Ophcf2|02477
Ophiocordyceps camponoti-rufipedis Ophun1|5458
Ophiocordyceps kimflemingae Ophio5|487
Ophiocordyceps subramaniannii Hirsu2|2808

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4081
MASHNDDTMPDETHGYKLSQPKQSLAQYEQMDAGDESLRRYKKSLGLGGGKDISDANDPRVCIILSLTMDSPGRD
AVTIDLSQAGSEKTLKDKPFKIKEGAKFTMSAEFKVQHEILSGLHYVQVVKRKGVRVSKDSEMIGSYAPNTDKQT
TYTKKFQEEEAPSGMLTRGHYHAISSFVDDDKKKHLEFEWSFDIAKDW*
Coding >OphauG2|4081
ATGGCCTCCCACAATGACGATACCATGCCCGACGAGACGCACGGCTACAAGCTCTCTCAGCCCAAACAAAGCTTG
GCCCAGTATGAGCAAATGGACGCCGGCGACGAGTCTCTGCGACGGTACAAGAAATCTCTAGGCCTCGGCGGCGGA
AAAGATATTTCAGACGCAAACGACCCTCGAGTTTGCATCATTCTCTCCCTTACAATGGACTCCCCCGGCCGCGAT
GCCGTTACCATTGATCTCTCCCAGGCTGGCAGCGAAAAGACTCTCAAGGACAAGCCCTTTAAAATCAAGGAGGGT
GCCAAATTTACCATGAGCGCAGAGTTCAAGGTGCAGCACGAGATTCTCAGTGGCTTGCACTATGTCCAGGTCGTC
AAGCGCAAGGGCGTCAGAGTGTCCAAAGACTCGGAAATGATTGGTAGCTACGCCCCCAACACGGACAAGCAAACA
ACATACACCAAAAAGTTTCAAGAAGAGGAGGCCCCTTCTGGAATGCTTACCCGTGGCCATTATCATGCCATTTCC
AGCTTTGTCGACGACGACAAAAAGAAGCACCTCGAATTTGAATGGAGTTTCGACATTGCCAAGGATTGGTAA
Transcript >OphauG2|4081
ATGGCCTCCCACAATGACGATACCATGCCCGACGAGACGCACGGCTACAAGCTCTCTCAGCCCAAACAAAGCTTG
GCCCAGTATGAGCAAATGGACGCCGGCGACGAGTCTCTGCGACGGTACAAGAAATCTCTAGGCCTCGGCGGCGGA
AAAGATATTTCAGACGCAAACGACCCTCGAGTTTGCATCATTCTCTCCCTTACAATGGACTCCCCCGGCCGCGAT
GCCGTTACCATTGATCTCTCCCAGGCTGGCAGCGAAAAGACTCTCAAGGACAAGCCCTTTAAAATCAAGGAGGGT
GCCAAATTTACCATGAGCGCAGAGTTCAAGGTGCAGCACGAGATTCTCAGTGGCTTGCACTATGTCCAGGTCGTC
AAGCGCAAGGGCGTCAGAGTGTCCAAAGACTCGGAAATGATTGGTAGCTACGCCCCCAACACGGACAAGCAAACA
ACATACACCAAAAAGTTTCAAGAAGAGGAGGCCCCTTCTGGAATGCTTACCCGTGGCCATTATCATGCCATTTCC
AGCTTTGTCGACGACGACAAAAAGAAGCACCTCGAATTTGAATGGAGTTTCGACATTGCCAAGGATTGGTAA
Gene >OphauG2|4081
ATGGCCTCCCACAATGACGATACCATGCCCGACGAGACGCACGGCTACAAGCTCTCTCAGCCCAAACAAAGCTTG
GCCCAGTATGAGCAAATGGGTATGCCAAGTCATTTCCCCACGACCCCAAGAGCAATTGCATTGCTCGCCATCTCT
CTTGTCCCTCTAATCGCCTTGAGCTTCCCATGAGCTTCCCGTCAACCCTTTTCTTCTCCTTCTTCTACATCACTT
TGCCCCGCCAAGCCACCAAACAAACCCGTTGTTGTGTAAACAGCAAAACCCTTACTAACAATGCCATCTGCGCCC
TATTTAAACAGACGCCGGCGACGAGTCTCTGCGACGGTACAAGAAATCTCTAGGCCTCGGCGGCGGAAAAGATAT
TTCAGACGCAAACGACCCTCGAGTTTGCATCATTCTCTCCCTTACAATGGACTCCCCCGGCCGCGATGCCGTTAC
CATTGATCTCTCCCAGGCTGGCAGCGAAAAGACTCTCAAGGACAAGCCCTTTAAAATCAAGGAGGGTGCCAAATT
TACCATGAGCGCAGAGTTCAAGGTGCAGCACGAGATTCTCAGTGGCTTGCACTATGTCCAGGTCGTCAAGCGCAA
GGGCGTCAGAGTGTCCAAAGACTCGGAAATGATTGTGAGCAAACCCATATCCACGGCTCCTTGCGCACGGGCATG
CATTATCTGACCTTGCACAGGGTAGCTACGCCCCCAACACGGACAAGCAAACAACATACACCAAAAAGTGTAAGA
CATGCAGTCTTGCCCTTGCCTCTTTTCCCTTGATCTGTGTCATGCCGTCGCTGACACCATGTGCTTTTTAGTTCA
AGAAGAGGAGGCCCCTTCTGGAATGCTTACCCGTGGCCATTATCATGCCATTTCCAGCTTTGTCGACGACGACAA
AAAGAAGCACCTCGAATTTGAATGGAGTTTCGACATTGCCAAGGATTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail