Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4073
Gene name
LocationContig_328:493..3699
Strand-
Gene length (bp)3206
Transcript length (bp)3081
Coding sequence length (bp)3081
Protein length (aa) 1027

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 3.4E-65 680 992
PF16488 ArgoL2 Argonaute linker 2 domain 3.0E-11 522 568
PF16486 ArgoN N-terminal domain of argonaute 8.5E-11 125 284
PF08699 ArgoL1 Argonaute linker 1 domain 1.0E-08 312 351

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 113 1025 6.0E-78
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 457 1013 3.0E-71
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 113 1009 6.0E-71
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 454 994 3.0E-70
sp|Q8CJG0|AGO2_MOUSE Protein argonaute-2 OS=Mus musculus GN=Ago2 PE=1 SV=3 114 1025 5.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 113 1025 6.0E-78
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 457 1013 3.0E-71
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 113 1009 6.0E-71
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 454 994 3.0E-70
sp|Q8CJG0|AGO2_MOUSE Protein argonaute-2 OS=Mus musculus GN=Ago2 PE=1 SV=3 114 1025 5.0E-69
sp|Q9UKV8|AGO2_HUMAN Protein argonaute-2 OS=Homo sapiens GN=AGO2 PE=1 SV=3 114 1025 6.0E-69
sp|Q9QZ81|AGO2_RAT Protein argonaute-2 OS=Rattus norvegicus GN=Ago2 PE=2 SV=2 114 1025 8.0E-69
sp|Q6QME8|AGO2_BOVIN Protein argonaute-2 OS=Bos taurus GN=AGO2 PE=2 SV=1 114 1025 1.0E-68
sp|O77503|AGO2_RABIT Protein argonaute-2 (Fragment) OS=Oryctolagus cuniculus GN=AGO2 PE=1 SV=2 114 1025 2.0E-68
sp|Q9XGW1|AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana GN=AGO10 PE=2 SV=1 457 1001 5.0E-68
sp|Q69VD5|PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica GN=PHN1 PE=2 SV=1 450 1025 2.0E-67
sp|Q7Y001|AGO12_ORYSJ Protein argonaute 12 OS=Oryza sativa subsp. japonica GN=AGO12 PE=2 SV=2 456 1025 2.0E-67
sp|Q8CJF9|AGO3_MOUSE Protein argonaute-3 OS=Mus musculus GN=Ago3 PE=2 SV=2 101 1025 1.0E-66
sp|Q9H9G7|AGO3_HUMAN Protein argonaute-3 OS=Homo sapiens GN=AGO3 PE=1 SV=2 101 1025 1.0E-66
sp|Q851R2|MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1 457 1025 3.0E-66
sp|Q5ZLG4|AGO3_CHICK Protein argonaute-3 OS=Gallus gallus GN=AGO3 PE=2 SV=1 101 1025 1.0E-65
sp|Q6DCX2|AGO2_XENLA Protein argonaute-2 OS=Xenopus laevis GN=ago2 PE=2 SV=1 114 1025 1.0E-65
sp|Q6DJB9|AGO2_XENTR Protein argonaute-2 OS=Xenopus tropicalis GN=ago2 PE=2 SV=1 114 1025 2.0E-65
sp|A3KPK0|AGO3_DANRE Protein argonaute-3 OS=Danio rerio GN=ago3 PE=3 SV=1 101 1025 2.0E-65
sp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D OS=Oryza sativa subsp. japonica GN=AGO1D PE=2 SV=1 457 994 1.0E-64
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 113 1011 1.0E-64
sp|Q8CJG1|AGO1_MOUSE Protein argonaute-1 OS=Mus musculus GN=Ago1 PE=1 SV=2 114 1025 8.0E-64
sp|Q9UL18|AGO1_HUMAN Protein argonaute-1 OS=Homo sapiens GN=AGO1 PE=1 SV=3 114 1025 8.0E-64
sp|Q6Z4F1|AGO14_ORYSJ Protein argonaute 14 OS=Oryza sativa subsp. japonica GN=AGO14 PE=2 SV=1 114 1025 1.0E-63
sp|Q4KLV6|AGO4_XENLA Protein argonaute-4 OS=Xenopus laevis GN=ago4 PE=2 SV=1 110 1025 2.0E-63
sp|Q8CJF8|AGO4_MOUSE Protein argonaute-4 OS=Mus musculus GN=Ago4 PE=2 SV=2 114 1025 3.0E-63
sp|Q9HCK5|AGO4_HUMAN Protein argonaute-4 OS=Homo sapiens GN=AGO4 PE=1 SV=2 114 1025 6.0E-63
sp|P34681|TAG76_CAEEL Putative protein tag-76 OS=Caenorhabditis elegans GN=tag-76 PE=3 SV=2 448 994 2.0E-62
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 115 1026 4.0E-62
sp|Q6K972|AGO1C_ORYSJ Protein argonaute 1C OS=Oryza sativa subsp. japonica GN=AGO1C PE=2 SV=1 457 994 2.0E-61
sp|Q6T5B7|AGO3_BOVIN Protein argonaute-3 OS=Bos taurus GN=AGO3 PE=2 SV=2 101 1025 4.0E-61
sp|Q5ZMW0|AGO4_CHICK Protein argonaute-4 OS=Gallus gallus GN=AGO4 PE=2 SV=1 275 1025 5.0E-60
sp|Q10F39|AGO11_ORYSJ Protein argonaute 11 OS=Oryza sativa subsp. japonica GN=AGO11 PE=2 SV=2 428 992 1.0E-58
sp|Q9VUQ5|AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster GN=AGO2 PE=1 SV=3 324 994 1.0E-56
sp|Q9C793|AGO7_ARATH Protein argonaute 7 OS=Arabidopsis thaliana GN=AGO7 PE=2 SV=1 116 1025 5.0E-56
sp|Q75HC2|AGO7_ORYSJ Protein argonaute 7 OS=Oryza sativa subsp. japonica GN=AGO7 PE=2 SV=2 86 994 2.0E-55
sp|Q852N2|AGO13_ORYSJ Protein argonaute 13 OS=Oryza sativa subsp. japonica GN=AGO13 PE=2 SV=1 457 1022 6.0E-54
sp|Q9SDG8|AGO4A_ORYSJ Protein argonaute 4A OS=Oryza sativa subsp. japonica GN=AGO4A PE=2 SV=1 448 1025 6.0E-54
sp|Q9SHF2|AGO3_ARATH Protein argonaute 3 OS=Arabidopsis thaliana GN=AGO3 PE=3 SV=1 456 994 1.0E-52
sp|Q0JF58|AGO4B_ORYSJ Protein argonaute 4B OS=Oryza sativa subsp. japonica GN=AGO4B PE=2 SV=1 447 1025 2.0E-52
sp|Q9ZVD5|AGO4_ARATH Protein argonaute 4 OS=Arabidopsis thaliana GN=AGO4 PE=1 SV=2 448 1008 2.0E-51
sp|Q9SHF3|AGO2_ARATH Protein argonaute 2 OS=Arabidopsis thaliana GN=AGO2 PE=1 SV=1 440 994 2.0E-51
sp|Q84VQ0|AGO9_ARATH Protein argonaute 9 OS=Arabidopsis thaliana GN=AGO9 PE=1 SV=2 441 1025 3.0E-50
sp|Q6YSJ5|AGO16_ORYSJ Protein argonaute 16 OS=Oryza sativa subsp. japonica GN=AGO16 PE=2 SV=2 325 1025 3.0E-49
sp|Q7XTS4|AGO2_ORYSJ Protein argonaute 2 OS=Oryza sativa subsp. japonica GN=AGO2 PE=2 SV=2 441 994 1.0E-48
sp|Q6H6C3|AGO17_ORYSJ Protein argonaute 17 OS=Oryza sativa subsp. japonica GN=AGO17 PE=2 SV=1 473 1025 3.0E-48
sp|Q5NBN9|AGO15_ORYSJ Protein argonaute 15 OS=Oryza sativa subsp. japonica GN=AGO15 PE=2 SV=2 456 1025 5.0E-48
sp|O48771|AGO6_ARATH Protein argonaute 6 OS=Arabidopsis thaliana GN=AGO6 PE=2 SV=2 456 1025 3.0E-46
sp|Q7XTS3|AGO3_ORYSJ Protein argonaute 3 OS=Oryza sativa subsp. japonica GN=AGO3 PE=2 SV=2 544 994 5.0E-44
sp|Q3E984|AGO8_ARATH Protein argonaute 8 OS=Arabidopsis thaliana GN=AGO8 PE=3 SV=1 473 1008 3.0E-40
sp|A6N7Y9|PIWL1_CHICK Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1 322 984 2.0E-27
sp|Q21770|WAGO1_CAEEL Argonaute protein wago-1 OS=Caenorhabditis elegans GN=wago-1 PE=1 SV=1 457 992 7.0E-27
sp|Q8UVX0|PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1 527 984 2.0E-25
sp|Q7PLK0|AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster GN=AGO3 PE=1 SV=3 687 984 6.0E-25
sp|A2CEI6|PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio GN=piwil2 PE=1 SV=2 541 984 7.0E-25
sp|Q96J94|PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1 SV=1 680 984 3.0E-24
sp|Q8CGT6|PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus GN=Piwil4 PE=1 SV=3 456 984 7.0E-24
sp|Q9JMB7|PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1 SV=1 680 984 4.0E-23
sp|Q4G033|PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus GN=Piwil4 PE=2 SV=2 460 984 7.0E-23
sp|A8KBF3|PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis GN=piwil2 PE=1 SV=1 456 984 3.0E-22
sp|Q8TC59|PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens GN=PIWIL2 PE=1 SV=1 540 984 7.0E-22
sp|Q8CDG1|PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus GN=Piwil2 PE=1 SV=2 540 984 8.0E-22
sp|O61931|ERGO1_CAEEL Piwi-like protein ergo-1 OS=Caenorhabditis elegans GN=ergo-1 PE=1 SV=2 693 992 2.0E-21
sp|Q7Z3Z3|PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens GN=PIWIL3 PE=2 SV=2 521 984 3.0E-21
sp|A6P7L8|PIWL2_ONCMY Piwi-like protein 2 OS=Oncorhynchus mykiss GN=piwil2 PE=2 SV=1 541 984 2.0E-19
sp|Q09249|YQ53_CAEEL Uncharacterized protein C16C10.3 OS=Caenorhabditis elegans GN=C16C10.3 PE=3 SV=1 444 992 5.0E-18
sp|O76922|AUB_DROME Protein aubergine OS=Drosophila melanogaster GN=aub PE=1 SV=1 406 1026 9.0E-18
sp|Q9VKM1|PIWI_DROME Protein piwi OS=Drosophila melanogaster GN=piwi PE=1 SV=1 456 978 2.0E-17
sp|Q7Z3Z4|PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens GN=PIWIL4 PE=2 SV=2 726 984 1.0E-15
sp|Q2Q5Y9|PIWI1_SCHMD Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1 456 995 2.0E-15
sp|Q2PC95|PIWIL_DUGJA Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1 755 1019 5.0E-13
sp|Q2Q5Y8|PIWI2_SCHMD Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1 755 995 5.0E-12
sp|Q21691|NRDE3_CAEEL Nuclear RNAi defective-3 protein OS=Caenorhabditis elegans GN=nrde-3 PE=1 SV=1 442 981 3.0E-09
sp|Q86QW7|AGO_GIAIN Protein argonaute OS=Giardia intestinalis GN=Ago PE=1 SV=2 672 977 3.0E-09
sp|A8BCK6|AGO_GIAIC Protein argonaute OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=Ago PE=3 SV=1 672 977 3.0E-09
sp|C6LTG5|AGO_GIAIB Protein argonaute OS=Giardia intestinalis (strain ATCC 50581 / GS clone H7) GN=Ago PE=3 SV=1 677 977 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup737
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4073 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|439
Ophiocordyceps camponoti-floridani Ophcf2|01255
Ophiocordyceps camponoti-rufipedis Ophun1|2293
Ophiocordyceps kimflemingae Ophio5|8502
Ophiocordyceps subramaniannii Hirsu2|1954
Ophiocordyceps subramaniannii Hirsu2|978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4073
MADRTGRGGGGGRGGGRGRGGGGRGGGYGRGGHHGGANEGGYRGGGGYGRGGHRGGAHEGGYRGGRGPSAPVLAF
TGNDDRIPDPDKKVTELENRVAKAHSSGTAKAGSTDIFPLRPAFGSRGDAVTLWANYFSVQFKGVVLYKYTVEFA
QVGTGSTSQDKPVDKAPKAGKTQTKEVKGRKLYFAFCELLNTLRATDKKLVLATEYKSQLISCQKLNLNENPIQF
RLNFESSEDKWDVLEATIHGPTEAPLDALLQYISTMDDGPGNITFPKYPDAIDALNVVLGYRPRSRLDQVSTLGS
SRYFPFAEGKVLTNLFHDSRLLLAARGFFQSARLGTGRLLLNTNVTHGLFRASGKLDELYTSFRIRLALPSDASA
LRDIRAFAKFLPKTRVWATFTVNGKSVRKSKSIHAMLVKTDFSRQSSSNDHPLKFHGDYLYPGPKQVEFWRNDSE
GQSGYISVFNHYKSKYNKTLKDLPLVNIGNANKPLLFPAEMVEIQPGQSVKVKLTMAETTAMLDAACRTPYENAL
SISNDSRKTLGLDDDELGRFGISVDKKLLTVQGRVLPSPSVIYLKQMRSSSVIPSNGSWNMRQVTVVKTGAQISR
WSYLTISRPGDWRNGQLVIPEEIFGQFTDFLREKQGILMGKKPMVPSGASARQFMSWENAMNGELDTFFTWAKKQ
AVQYIFVVLAEKDSRGMYAKIKTLGDCIHGIHTSVVTSAQIQRENNFAYYSNVGLKVNLKAGGTNHALKEPHGLI
RDGHTMVVGYDVTHPTNMPQSTSGREPPSLVGLVATIAPDMGQWPAVSWEQASYQEMLSGELGAAFESRLALWHK
HNKAQYPKNIIIFRDGVSEGQFAQVLEKELPLIRQACRTVCPPQNSKIKLTIIVSVKRHQTRFYPTSKDTMSSSG
NVCNGTVVDRGVTQARYWDFFLTAHHALKGTARPAHYTVLLDEIFRAKYQSNAANELERMTHDMCYLYGRATKAV
SICPPAYYADIVCERARVHRPEMFDDAESVSSAAPANREIHNDLKNTMYYI*
Coding >OphauG2|4073
ATGGCTGATCGCACCGGTCGAGGCGGTGGCGGCGGTCGTGGCGGCGGCCGTGGCCGAGGCGGCGGAGGAAGAGGC
GGCGGTTATGGCCGTGGTGGACACCATGGAGGCGCGAATGAAGGCGGGTACAGAGGCGGCGGCGGTTATGGCCGT
GGTGGACACCGTGGAGGCGCGCACGAAGGCGGGTACAGAGGCGGCCGAGGCCCCTCAGCCCCCGTCCTTGCTTTC
ACCGGCAACGACGACCGCATCCCTGACCCCGACAAAAAAGTCACAGAGCTTGAGAATCGTGTCGCCAAGGCCCAT
TCCTCGGGGACCGCTAAGGCCGGGTCCACCGACATCTTCCCTCTGCGGCCCGCATTTGGCTCCAGAGGCGATGCC
GTCACGCTGTGGGCCAACTATTTCAGCGTCCAGTTCAAAGGCGTGGTGCTGTACAAGTACACCGTCGAATTCGCC
CAGGTTGGCACCGGGAGCACGTCGCAGGACAAGCCCGTGGACAAGGCGCCCAAGGCGGGTAAGACCCAGACCAAG
GAGGTCAAGGGCCGCAAGCTTTACTTTGCCTTCTGCGAGCTGCTCAACACGCTGCGCGCCACTGACAAAAAACTC
GTGCTCGCCACCGAGTACAAGAGCCAGCTCATCTCATGCCAAAAGCTCAATCTGAATGAGAACCCCATCCAGTTC
CGGCTGAACTTTGAGTCGTCTGAGGACAAGTGGGACGTGCTCGAGGCCACCATCCACGGCCCGACCGAGGCGCCC
CTCGACGCCCTGCTCCAATACATTAGCACCATGGACGACGGGCCGGGCAACATCACATTCCCCAAGTACCCAGAC
GCTATCGATGCCCTCAACGTGGTTCTGGGCTATCGCCCGCGCTCTCGCCTCGACCAAGTCTCCACCCTTGGCAGC
TCCCGTTACTTCCCCTTTGCCGAAGGCAAGGTCTTGACCAATCTTTTCCACGACTCTCGCCTGCTCCTCGCCGCC
CGCGGCTTCTTTCAGTCGGCCCGTCTTGGCACCGGCCGCCTGCTGCTCAACACAAACGTGACCCATGGTCTCTTC
CGCGCCTCGGGCAAGCTGGATGAACTCTACACTAGTTTCAGGATTCGGCTCGCCCTGCCCTCTGACGCGAGCGCC
CTAAGAGACATCAGGGCCTTCGCAAAGTTCTTGCCCAAGACACGTGTCTGGGCTACCTTTACCGTCAACGGCAAA
TCCGTCCGCAAATCCAAGTCCATACATGCCATGTTGGTCAAGACCGACTTCTCTCGCCAGTCCTCATCCAACGAC
CATCCCCTCAAGTTTCATGGCGACTACCTGTATCCAGGGCCCAAGCAAGTGGAGTTTTGGCGCAACGACAGCGAA
GGCCAATCCGGCTACATTAGTGTTTTTAACCACTATAAATCGAAGTACAACAAGACGCTCAAGGACTTGCCGCTG
GTCAACATTGGCAATGCCAATAAGCCCTTGCTGTTTCCCGCCGAAATGGTCGAGATCCAACCCGGCCAGTCGGTC
AAGGTCAAGCTGACAATGGCCGAGACGACGGCCATGCTGGATGCAGCCTGCCGCACGCCCTATGAAAATGCCCTA
TCCATTAGCAACGACAGCCGCAAGACTCTAGGGCTCGATGATGACGAGCTCGGGCGTTTCGGCATCTCGGTGGAC
AAGAAACTCTTGACGGTCCAGGGACGCGTGCTCCCATCTCCCTCGGTGATCTACCTCAAGCAGATGAGATCCAGC
AGCGTAATCCCCTCTAATGGCAGCTGGAACATGCGCCAAGTAACCGTCGTCAAGACGGGCGCTCAGATCAGTCGC
TGGAGCTACCTCACCATCAGCAGGCCGGGTGATTGGAGGAACGGCCAGTTGGTCATCCCAGAAGAAATCTTTGGG
CAATTTACCGACTTTCTGAGGGAAAAACAGGGCATTTTGATGGGTAAAAAGCCCATGGTTCCCAGCGGCGCTAGT
GCCAGGCAGTTCATGTCCTGGGAAAATGCCATGAACGGCGAGCTCGACACCTTCTTTACGTGGGCCAAGAAGCAG
GCGGTACAGTACATCTTCGTGGTCCTCGCGGAAAAGGACAGTCGGGGCATGTATGCCAAAATCAAGACGCTAGGA
GACTGCATCCACGGCATACACACCAGCGTCGTCACGTCGGCACAGATACAAAGGGAAAACAACTTTGCCTACTAC
TCCAACGTGGGGCTCAAGGTCAACCTCAAAGCCGGCGGTACCAACCACGCGCTCAAGGAACCCCACGGCCTGATC
CGGGACGGCCATACCATGGTTGTGGGCTACGACGTGACGCACCCGACCAACATGCCCCAGTCGACTTCCGGTCGG
GAACCGCCGAGTCTGGTTGGCCTCGTGGCGACGATTGCCCCGGATATGGGACAGTGGCCGGCGGTGTCGTGGGAA
CAGGCGTCGTATCAAGAGATGCTGAGCGGCGAGCTTGGGGCTGCCTTCGAGTCGCGGCTCGCGCTGTGGCACAAG
CACAACAAGGCCCAGTACCCAAAGAACATTATAATCTTTCGCGATGGCGTGTCTGAAGGACAGTTTGCACAGGTG
CTGGAAAAGGAGCTGCCGTTGATCCGCCAAGCCTGCCGCACCGTATGCCCACCACAGAATTCCAAGATCAAGCTG
ACCATCATCGTCTCGGTCAAGCGTCACCAGACGCGCTTCTACCCGACCAGCAAAGATACCATGTCGAGCTCGGGT
AACGTGTGCAACGGCACCGTTGTCGACCGCGGCGTCACCCAGGCCCGCTACTGGGACTTCTTCCTGACGGCGCAC
CACGCGCTCAAGGGCACGGCGCGTCCCGCCCACTACACGGTGCTCCTCGACGAGATCTTTCGTGCCAAGTATCAG
TCGAATGCCGCCAACGAGCTCGAGCGCATGACGCACGACATGTGCTACCTATATGGCCGCGCCACAAAGGCAGTT
AGCATCTGTCCGCCCGCCTACTATGCCGACATTGTCTGTGAGCGCGCCCGCGTCCACCGGCCCGAAATGTTTGAC
GACGCGGAGAGCGTCTCTAGCGCCGCCCCGGCCAACCGGGAGATCCACAATGACCTCAAGAACACCATGTACTAC
ATCTAG
Transcript >OphauG2|4073
ATGGCTGATCGCACCGGTCGAGGCGGTGGCGGCGGTCGTGGCGGCGGCCGTGGCCGAGGCGGCGGAGGAAGAGGC
GGCGGTTATGGCCGTGGTGGACACCATGGAGGCGCGAATGAAGGCGGGTACAGAGGCGGCGGCGGTTATGGCCGT
GGTGGACACCGTGGAGGCGCGCACGAAGGCGGGTACAGAGGCGGCCGAGGCCCCTCAGCCCCCGTCCTTGCTTTC
ACCGGCAACGACGACCGCATCCCTGACCCCGACAAAAAAGTCACAGAGCTTGAGAATCGTGTCGCCAAGGCCCAT
TCCTCGGGGACCGCTAAGGCCGGGTCCACCGACATCTTCCCTCTGCGGCCCGCATTTGGCTCCAGAGGCGATGCC
GTCACGCTGTGGGCCAACTATTTCAGCGTCCAGTTCAAAGGCGTGGTGCTGTACAAGTACACCGTCGAATTCGCC
CAGGTTGGCACCGGGAGCACGTCGCAGGACAAGCCCGTGGACAAGGCGCCCAAGGCGGGTAAGACCCAGACCAAG
GAGGTCAAGGGCCGCAAGCTTTACTTTGCCTTCTGCGAGCTGCTCAACACGCTGCGCGCCACTGACAAAAAACTC
GTGCTCGCCACCGAGTACAAGAGCCAGCTCATCTCATGCCAAAAGCTCAATCTGAATGAGAACCCCATCCAGTTC
CGGCTGAACTTTGAGTCGTCTGAGGACAAGTGGGACGTGCTCGAGGCCACCATCCACGGCCCGACCGAGGCGCCC
CTCGACGCCCTGCTCCAATACATTAGCACCATGGACGACGGGCCGGGCAACATCACATTCCCCAAGTACCCAGAC
GCTATCGATGCCCTCAACGTGGTTCTGGGCTATCGCCCGCGCTCTCGCCTCGACCAAGTCTCCACCCTTGGCAGC
TCCCGTTACTTCCCCTTTGCCGAAGGCAAGGTCTTGACCAATCTTTTCCACGACTCTCGCCTGCTCCTCGCCGCC
CGCGGCTTCTTTCAGTCGGCCCGTCTTGGCACCGGCCGCCTGCTGCTCAACACAAACGTGACCCATGGTCTCTTC
CGCGCCTCGGGCAAGCTGGATGAACTCTACACTAGTTTCAGGATTCGGCTCGCCCTGCCCTCTGACGCGAGCGCC
CTAAGAGACATCAGGGCCTTCGCAAAGTTCTTGCCCAAGACACGTGTCTGGGCTACCTTTACCGTCAACGGCAAA
TCCGTCCGCAAATCCAAGTCCATACATGCCATGTTGGTCAAGACCGACTTCTCTCGCCAGTCCTCATCCAACGAC
CATCCCCTCAAGTTTCATGGCGACTACCTGTATCCAGGGCCCAAGCAAGTGGAGTTTTGGCGCAACGACAGCGAA
GGCCAATCCGGCTACATTAGTGTTTTTAACCACTATAAATCGAAGTACAACAAGACGCTCAAGGACTTGCCGCTG
GTCAACATTGGCAATGCCAATAAGCCCTTGCTGTTTCCCGCCGAAATGGTCGAGATCCAACCCGGCCAGTCGGTC
AAGGTCAAGCTGACAATGGCCGAGACGACGGCCATGCTGGATGCAGCCTGCCGCACGCCCTATGAAAATGCCCTA
TCCATTAGCAACGACAGCCGCAAGACTCTAGGGCTCGATGATGACGAGCTCGGGCGTTTCGGCATCTCGGTGGAC
AAGAAACTCTTGACGGTCCAGGGACGCGTGCTCCCATCTCCCTCGGTGATCTACCTCAAGCAGATGAGATCCAGC
AGCGTAATCCCCTCTAATGGCAGCTGGAACATGCGCCAAGTAACCGTCGTCAAGACGGGCGCTCAGATCAGTCGC
TGGAGCTACCTCACCATCAGCAGGCCGGGTGATTGGAGGAACGGCCAGTTGGTCATCCCAGAAGAAATCTTTGGG
CAATTTACCGACTTTCTGAGGGAAAAACAGGGCATTTTGATGGGTAAAAAGCCCATGGTTCCCAGCGGCGCTAGT
GCCAGGCAGTTCATGTCCTGGGAAAATGCCATGAACGGCGAGCTCGACACCTTCTTTACGTGGGCCAAGAAGCAG
GCGGTACAGTACATCTTCGTGGTCCTCGCGGAAAAGGACAGTCGGGGCATGTATGCCAAAATCAAGACGCTAGGA
GACTGCATCCACGGCATACACACCAGCGTCGTCACGTCGGCACAGATACAAAGGGAAAACAACTTTGCCTACTAC
TCCAACGTGGGGCTCAAGGTCAACCTCAAAGCCGGCGGTACCAACCACGCGCTCAAGGAACCCCACGGCCTGATC
CGGGACGGCCATACCATGGTTGTGGGCTACGACGTGACGCACCCGACCAACATGCCCCAGTCGACTTCCGGTCGG
GAACCGCCGAGTCTGGTTGGCCTCGTGGCGACGATTGCCCCGGATATGGGACAGTGGCCGGCGGTGTCGTGGGAA
CAGGCGTCGTATCAAGAGATGCTGAGCGGCGAGCTTGGGGCTGCCTTCGAGTCGCGGCTCGCGCTGTGGCACAAG
CACAACAAGGCCCAGTACCCAAAGAACATTATAATCTTTCGCGATGGCGTGTCTGAAGGACAGTTTGCACAGGTG
CTGGAAAAGGAGCTGCCGTTGATCCGCCAAGCCTGCCGCACCGTATGCCCACCACAGAATTCCAAGATCAAGCTG
ACCATCATCGTCTCGGTCAAGCGTCACCAGACGCGCTTCTACCCGACCAGCAAAGATACCATGTCGAGCTCGGGT
AACGTGTGCAACGGCACCGTTGTCGACCGCGGCGTCACCCAGGCCCGCTACTGGGACTTCTTCCTGACGGCGCAC
CACGCGCTCAAGGGCACGGCGCGTCCCGCCCACTACACGGTGCTCCTCGACGAGATCTTTCGTGCCAAGTATCAG
TCGAATGCCGCCAACGAGCTCGAGCGCATGACGCACGACATGTGCTACCTATATGGCCGCGCCACAAAGGCAGTT
AGCATCTGTCCGCCCGCCTACTATGCCGACATTGTCTGTGAGCGCGCCCGCGTCCACCGGCCCGAAATGTTTGAC
GACGCGGAGAGCGTCTCTAGCGCCGCCCCGGCCAACCGGGAGATCCACAATGACCTCAAGAACACCATGTACTAC
ATCTAG
Gene >OphauG2|4073
ATGGCTGATCGCACCGGTCGAGGCGGTGGCGGCGGTCGTGGCGGCGGCCGTGGCCGAGGCGGCGGAGGAAGAGGC
GGCGGTTATGGCCGTGGTGGACACCATGGAGGCGCGAATGAAGGCGGGTACAGAGGCGGCGGCGGTTATGGCCGT
GGTGGACACCGTGGAGGCGCGCACGAAGGCGGGTACAGAGGCGGCCGAGGCCCCTCAGCCCCCGTCCTTGCTTTC
ACGTAATATCTTCTTCCCCCATTTTCATAAGCCTCATCACGCTGACATAACGTGCTTGTAGCGGCAACGACGACC
GCATCCCTGACCCCGACAAAAAAGTCACAGAGCTTGAGAATCGTGTCGCCAAGGCCCATTCCTCGGGGACCGCTA
AGGCCGGGTCCACCGACATCTTCCCTCTGCGGCCCGCATTTGGCTCCAGAGGCGATGCCGTCACGCTGTGGGCCA
ACTATTTCAGCGTCCAGTTCAAAGGCGTGGTGCTGTACAAGTACACCGTCGAATTCGCCCAGGTTGGCACCGGGA
GCACGTCGCAGGACAAGCCCGTGGACAAGGCGCCCAAGGCGGGTAAGACCCAGACCAAGGAGGTCAAGGGCCGCA
AGCTTTACTTTGCCTTCTGCGAGCTGCTCAACACGCTGCGCGCCACTGACAAAAAACTCGTGCTCGCCACCGAGT
ACAAGAGCCAGCTCATCTCATGCCAAAAGCTCAATCTGAATGAGAACCCCATCCAGTTCCGGCTGAACTTTGAGT
CGTCTGAGGACAAGTGGGACGTGCTCGAGGCCACCATCCACGGCCCGACCGAGGCGCCCCTCGACGCCCTGCTCC
AATACATTAGCACCATGGACGACGGGCCGGGCAACATCACATTCCCCAAGTACCCAGACGCTATCGATGCCCTCA
ACGTGGTTCTGGGCTATCGCCCGCGCTCTCGCCTCGACCAAGTCTCCACCCTTGGCAGCTCCCGTTACTTCCCCT
TTGCCGAAGGCAAGGTCTTGACCAATCTTTTCCACGACTCTCGCCTGCTCCTCGCCGCCCGCGGCTTCTTTCAGT
CGGCCCGTCTTGGCACCGGCCGCCTGCTGCTCAACACAAACGTGACCCATGGTCTCTTCCGCGCCTCGGGCAAGC
TGGATGAACTCTACACTAGTTTCAGGATTCGGCTCGCCCTGCCCTCTGACGCGAGCGCCCTAAGAGACATCAGGG
CCTTCGCAAAGTTCTTGCCCAAGACACGTGTCTGGGCTACCTTTACCGTCAACGGCAAATCCGTCCGCAAATCCA
AGTCCATACATGCCATGTTGGTCAAGACCGACTTCTCTCGCCAGTCCTCATCCAACGACCATCCCCTCAAGTTTC
ATGGCGACTACCTGTATCCAGGGCCCAAGCAAGTGGAGTTTTGGCGCAACGACAGCGAAGGCCAATCCGGCTACA
TTAGTGTTTTTAACCACTATAAATCGAGTGAGTCTTGTCTTCTAACACTGGCCCCCAATCCCGCATCAACTAACG
TCGTTGCCACCCCAATAGAGTACAACAAGACGCTCAAGGACTTGCCGCTGGTCAACATTGGCAATGCCAATAAGC
CCTTGCTGTTTCCCGCCGAAATGGTCGAGATCCAACCCGGCCAGTCGGTCAAGGTCAAGCTGACAATGGCCGAGA
CGACGGCCATGCTGGATGCAGCCTGCCGCACGCCCTATGAAAATGCCCTATCCATTAGCAACGACAGCCGCAAGA
CTCTAGGGCTCGATGATGACGAGCTCGGGCGTTTCGGCATCTCGGTGGACAAGAAACTCTTGACGGTCCAGGGAC
GCGTGCTCCCATCTCCCTCGGTGATCTACCTCAAGCAGATGAGATCCAGCAGCGTAATCCCCTCTAATGGCAGCT
GGAACATGCGCCAAGTAACCGTCGTCAAGACGGGCGCTCAGATCAGTCGCTGGAGCTACCTCACCATCAGCAGGC
CGGGTGATTGGAGGAACGGCCAGTTGGTCATCCCAGAAGAAATCTTTGGGCAATTTACCGACTTTCTGAGGGAAA
AACAGGGCATTTTGATGGGTAAAAAGCCCATGGTTCCCAGCGGCGCTAGTGCCAGGCAGTTCATGTCCTGGGAAA
ATGCCATGAACGGCGAGCTCGACACCTTCTTTACGTGGGCCAAGAAGCAGGCGGTACAGTACATCTTCGTGGTCC
TCGCGGAAAAGGACAGTCGGGGCATGTATGCCAAAATCAAGACGCTAGGAGACTGCATCCACGGCATACACACCA
GCGTCGTCACGTCGGCACAGATACAAAGGGAAAACAACTTTGCCTACTACTCCAACGTGGGGCTCAAGGTCAACC
TCAAAGCCGGCGGTACCAACCACGCGCTCAAGGAACCCCACGGCCTGATCCGGGACGGCCATACCATGGTTGTGG
GCTACGACGTGACGCACCCGACCAACATGCCCCAGTCGACTTCCGGTCGGGAACCGCCGAGTCTGGTTGGCCTCG
TGGCGACGATTGCCCCGGATATGGGACAGTGGCCGGCGGTGTCGTGGGAACAGGCGTCGTATCAAGAGATGCTGA
GCGGCGAGCTTGGGGCTGCCTTCGAGTCGCGGCTCGCGCTGTGGCACAAGCACAACAAGGCCCAGTACCCAAAGA
ACATTATAATCTTTCGCGATGGCGTGTCTGAAGGACAGTTTGCACAGGTGCTGGAAAAGGAGCTGCCGTTGATCC
GCCAAGCCTGCCGCACCGTATGCCCACCACAGAATTCCAAGATCAAGCTGACCATCATCGTCTCGGTCAAGCGTC
ACCAGACGCGCTTCTACCCGACCAGCAAAGATACCATGTCGAGCTCGGGTAACGTGTGCAACGGCACCGTTGTCG
ACCGCGGCGTCACCCAGGCCCGCTACTGGGACTTCTTCCTGACGGCGCACCACGCGCTCAAGGGCACGGCGCGTC
CCGCCCACTACACGGTGCTCCTCGACGAGATCTTTCGTGCCAAGTATCAGTCGAATGCCGCCAACGAGCTCGAGC
GCATGACGCACGACATGTGCTACCTATATGGCCGCGCCACAAAGGCAGTTAGCATCTGTCCGCCCGCCTACTATG
CCGACATTGTCTGTGAGCGCGCCCGCGTCCACCGGCCCGAAATGTTTGACGACGCGGAGAGCGTCTCTAGCGCCG
CCCCGGCCAACCGGGAGATCCACAATGACCTCAAGAACACCATGTACTACATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail