Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4059
Gene name
LocationContig_325:11147..12715
Strand+
Gene length (bp)1568
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 7.0E-34 28 384

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94512|OBP1_SCHPO Oxysterol-binding protein-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=obp1 PE=1 SV=1 15 452 2.0E-116
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 27 427 1.0E-33
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 14 430 2.0E-31
sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens GN=OSBPL11 PE=1 SV=2 43 424 5.0E-29
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 30 425 8.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94512|OBP1_SCHPO Oxysterol-binding protein-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=obp1 PE=1 SV=1 15 452 2.0E-116
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 27 427 1.0E-33
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 14 430 2.0E-31
sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens GN=OSBPL11 PE=1 SV=2 43 424 5.0E-29
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 30 425 8.0E-29
sp|Q8CI95|OSB11_MOUSE Oxysterol-binding protein-related protein 11 OS=Mus musculus GN=Osbpl11 PE=1 SV=2 43 424 1.0E-28
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 44 425 2.0E-28
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 47 424 5.0E-28
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 47 424 5.0E-28
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 14 424 7.0E-28
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 30 424 7.0E-28
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 27 427 1.0E-27
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 47 424 1.0E-25
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 47 424 1.0E-25
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 47 424 2.0E-25
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 47 424 1.0E-24
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 28 424 3.0E-21
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 2 427 3.0E-21
sp|Q54EF5|OSB12_DICDI Oxysterol-binding protein 12 OS=Dictyostelium discoideum GN=osbL PE=3 SV=1 47 424 2.0E-18
sp|P35844|KES1_YEAST Oxysterol-binding protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KES1 PE=1 SV=1 179 425 3.0E-18
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 178 424 1.0E-17
sp|O74178|KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kes1 PE=2 SV=2 21 425 5.0E-17
sp|Q9SVZ9|ORP4A_ARATH Oxysterol-binding protein-related protein 4A OS=Arabidopsis thaliana GN=ORP4A PE=2 SV=2 10 431 2.0E-16
sp|Q9SW00|ORP4B_ARATH Oxysterol-binding protein-related protein 4B OS=Arabidopsis thaliana GN=ORP4B PE=2 SV=2 10 424 4.0E-16
sp|P35843|HES1_YEAST Protein HES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HES1 PE=1 SV=1 179 427 2.0E-15
sp|O43021|YGV7_SCHPO Oxysterol-binding protein homolog C354.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.07c PE=3 SV=4 11 425 3.0E-15
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 29 412 1.0E-13
sp|Q8MPQ7|OSB1_DICDI Oxysterol-binding protein 1 OS=Dictyostelium discoideum GN=osbA PE=1 SV=1 21 429 5.0E-13
sp|Q9LVD4|ORP4C_ARATH Oxysterol-binding protein-related protein 4C OS=Arabidopsis thaliana GN=ORP4C PE=2 SV=1 164 424 9.0E-13
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 14 410 4.0E-11
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 176 425 2.0E-10
sp|Q54RM1|OSB7_DICDI Oxysterol-binding protein 7 OS=Dictyostelium discoideum GN=osbG PE=3 SV=1 10 444 1.0E-09
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 178 450 3.0E-09
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 178 427 1.0E-08
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 43 425 5.0E-08
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 178 440 8.0E-08
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 176 425 3.0E-07
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 178 424 6.0E-07
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 179 424 7.0E-07
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 176 427 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008289 lipid binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4593
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4059 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7906
Ophiocordyceps camponoti-floridani Ophcf2|05254
Ophiocordyceps camponoti-rufipedis Ophun1|1980
Ophiocordyceps kimflemingae Ophio5|1967
Ophiocordyceps subramaniannii Hirsu2|9641

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4059
MASPAVTPPVEAPDETPQSESSKLRTFLGILKKFIGVSDLAAVRFSLPSQLLEPTPNLEYWTYLDAPNAFVAIGT
SDEPLDRFLEVVRFWLTKDLKYVKGKPCKPYNSCLGEFFRCNWETKDDAPRIDTLHLSRANSPDANASSSNLKTT
LKGDKNASSLSVPHHSSSPDGHLVRVSYLTEQTSHHPPVSAFYVSCPEKGITARGFDQISAKFTGTSVKVLPGEH
NMGIFITLDKRDGETYQLTHPAAHLGGLLRGSLSVSVSEMAYIRCPRTKIKAILHYVEEGWLGRSTNKIDGVIFK
YDPDKDDKTRVQDVPNEDVLARISGPWREKVIFTLGGRPVKSVPADEQHTIIDVEPLSVAPKVVPPEDMQMPNES
LVLWSGVTKAIHAKQFSKATALKVELEEGQREKARQRLQSSEEWKPVFFEHVVGNGGKPDLTLKGKQVLERAQQD
DWSMDGII*
Coding >OphauG2|4059
ATGGCCTCGCCCGCGGTAACGCCTCCAGTCGAAGCTCCAGACGAAACCCCCCAAAGCGAAAGTTCCAAACTCCGC
ACCTTTCTCGGCATTTTGAAAAAATTTATCGGTGTTTCAGACCTCGCTGCCGTTCGCTTCTCCCTCCCCTCCCAG
CTACTCGAGCCGACGCCCAACCTTGAATACTGGACCTATCTCGATGCTCCCAATGCTTTTGTCGCCATCGGCACC
TCGGATGAGCCCCTGGATCGCTTCCTTGAGGTGGTCCGCTTCTGGCTTACAAAAGACCTCAAATATGTCAAAGGC
AAGCCATGCAAGCCGTACAACTCGTGCCTGGGTGAATTCTTCAGGTGTAACTGGGAAACCAAGGACGATGCACCC
AGGATCGATACCTTGCATCTTTCGCGCGCCAACTCGCCTGACGCGAACGCCTCATCCTCCAACCTCAAGACAACA
CTCAAGGGGGACAAGAACGCGTCCTCGCTTTCAGTTCCACACCACAGTTCTTCTCCAGATGGCCACTTAGTTCGT
GTCTCGTATCTAACTGAACAGACCTCACACCATCCTCCAGTCAGCGCCTTCTATGTCAGTTGCCCGGAAAAGGGA
ATCACGGCCCGGGGGTTTGATCAGATAAGCGCAAAGTTCACCGGTACCTCGGTCAAGGTTCTCCCCGGCGAACAC
AACATGGGCATCTTCATCACGCTCGATAAGCGCGACGGGGAGACATACCAGCTCACTCACCCTGCCGCTCATCTT
GGCGGACTGTTGCGAGGCAGTCTCAGCGTTTCCGTCAGCGAAATGGCATACATTCGGTGCCCGCGAACCAAAATC
AAAGCCATCCTGCACTACGTTGAAGAAGGCTGGCTCGGGCGAAGTACGAATAAGATTGATGGGGTCATCTTCAAA
TACGATCCTGATAAGGACGACAAAACAAGAGTCCAAGACGTGCCAAACGAGGACGTGCTGGCCAGAATTAGCGGT
CCTTGGAGGGAAAAGGTCATCTTCACTCTTGGTGGTCGACCCGTTAAATCCGTCCCTGCCGATGAACAACACACC
ATCATCGATGTCGAGCCCCTGAGTGTCGCCCCCAAGGTTGTACCGCCAGAGGATATGCAAATGCCCAACGAATCT
CTTGTGCTGTGGTCTGGCGTCACCAAAGCCATACACGCCAAACAATTTTCCAAAGCCACAGCTCTCAAGGTTGAA
CTCGAGGAAGGCCAGCGCGAAAAGGCCCGGCAGCGCCTTCAGTCGAGCGAGGAATGGAAACCCGTTTTTTTCGAA
CATGTCGTTGGTAATGGCGGCAAGCCGGATCTGACCCTAAAGGGCAAACAGGTACTCGAGCGTGCCCAACAAGAC
GATTGGTCCATGGACGGCATCATTTAG
Transcript >OphauG2|4059
ATGGCCTCGCCCGCGGTAACGCCTCCAGTCGAAGCTCCAGACGAAACCCCCCAAAGCGAAAGTTCCAAACTCCGC
ACCTTTCTCGGCATTTTGAAAAAATTTATCGGTGTTTCAGACCTCGCTGCCGTTCGCTTCTCCCTCCCCTCCCAG
CTACTCGAGCCGACGCCCAACCTTGAATACTGGACCTATCTCGATGCTCCCAATGCTTTTGTCGCCATCGGCACC
TCGGATGAGCCCCTGGATCGCTTCCTTGAGGTGGTCCGCTTCTGGCTTACAAAAGACCTCAAATATGTCAAAGGC
AAGCCATGCAAGCCGTACAACTCGTGCCTGGGTGAATTCTTCAGGTGTAACTGGGAAACCAAGGACGATGCACCC
AGGATCGATACCTTGCATCTTTCGCGCGCCAACTCGCCTGACGCGAACGCCTCATCCTCCAACCTCAAGACAACA
CTCAAGGGGGACAAGAACGCGTCCTCGCTTTCAGTTCCACACCACAGTTCTTCTCCAGATGGCCACTTAGTTCGT
GTCTCGTATCTAACTGAACAGACCTCACACCATCCTCCAGTCAGCGCCTTCTATGTCAGTTGCCCGGAAAAGGGA
ATCACGGCCCGGGGGTTTGATCAGATAAGCGCAAAGTTCACCGGTACCTCGGTCAAGGTTCTCCCCGGCGAACAC
AACATGGGCATCTTCATCACGCTCGATAAGCGCGACGGGGAGACATACCAGCTCACTCACCCTGCCGCTCATCTT
GGCGGACTGTTGCGAGGCAGTCTCAGCGTTTCCGTCAGCGAAATGGCATACATTCGGTGCCCGCGAACCAAAATC
AAAGCCATCCTGCACTACGTTGAAGAAGGCTGGCTCGGGCGAAGTACGAATAAGATTGATGGGGTCATCTTCAAA
TACGATCCTGATAAGGACGACAAAACAAGAGTCCAAGACGTGCCAAACGAGGACGTGCTGGCCAGAATTAGCGGT
CCTTGGAGGGAAAAGGTCATCTTCACTCTTGGTGGTCGACCCGTTAAATCCGTCCCTGCCGATGAACAACACACC
ATCATCGATGTCGAGCCCCTGAGTGTCGCCCCCAAGGTTGTACCGCCAGAGGATATGCAAATGCCCAACGAATCT
CTTGTGCTGTGGTCTGGCGTCACCAAAGCCATACACGCCAAACAATTTTCCAAAGCCACAGCTCTCAAGGTTGAA
CTCGAGGAAGGCCAGCGCGAAAAGGCCCGGCAGCGCCTTCAGTCGAGCGAGGAATGGAAACCCGTTTTTTTCGAA
CATGTCGTTGGTAATGGCGGCAAGCCGGATCTGACCCTAAAGGGCAAACAGGTACTCGAGCGTGCCCAACAAGAC
GATTGGTCCATGGACGGCATCATTTAG
Gene >OphauG2|4059
ATGGCCTCGCCCGCGGTAACGCCTCCAGTCGAAGCTCCAGACGAAACCCCCCAAAGCGAAAGTTCCAAACTCCGC
ACCTTTCTCGGCATTTTGAAAAAGTCAGTCATCTGTCATTTCCCCATCGACTTTGCGCAACTCGATGTTGACAAC
ATACTACAGATTTATCGGTGTTTCAGACCTCGCTGCCGTTCGCTTCTCCCTCCCCTCCCAGCTACTCGAGCCGAC
GCCCAACCTTGAATACTGGACCTATCTCGATGCTCCCAATGCTTTTGTCGCCATCGGCACCTCGGATGAGCCCCT
GGATCGCTTCCTTGAGGTGGTCCGCTTCTGGCTTACAAAAGACCTCAAATATGTCAAAGGCAAGCCATGCAAGCC
GTACAACTCGTGCCTGGGTGAATTCTTCAGGGTTCGTCACACACTGTGATGCTGTACACATCGGTTGGGCTGACA
GTCTCGCGACAGTGTAACTGGGAAACCAAGGACGATGCACCCAGGATCGATACCTTGCATCTTTCGCGCGCCAAC
TCGCCTGACGCGAACGCCTCATCCTCCAACCTCAAGACAACACTCAAGGGGGACAAGAACGCGTCCTCGCTTTCA
GTTCCACACCACAGTTCTTCTCCAGATGGCCACTTAGTTCGTGTCTCGTATCTAACTGAACAGACCTCACACCAT
CCTCCAGTCAGCGCCTTCTATGTCAGTTGCCCGGAAAAGGGAATCACGGCCCGGGGGTTTGATCAGATAAGCGCA
AAGTTCACCGGTACCTCGGTCAAGGTTCTCCCCGGCGAACACAACATGGGCATCTTCATCACGCTCGATAAGCGC
GACGGGGAGACATACCAGCTCACTCACCCTGCCGCTCATCTTGGCGGACTGTTGCGAGGCAGTCTCAGCGTTTCC
GTCAGCGAAATGGCATACATTCGGTGCCCGCGAACCAAAATCAAAGCCATCCTGCACTACGTTGAAGAAGGCTGG
CTCGGGCGAAGTACGAATAAGATTGATGGGGTCATCTTCAAATACGATCCTGATAAGGACGACAAAACAAGAGTC
CAAGACGTGCCAAACGAGGACGTGCTGGCCAGAATTAGCGGTCCTTGGAGGGAAAAGGTCATCTTCACTCTTGGT
GGTCGACCCGTTGTAAGTAGCCTCTTGGCGCCATTGGAATAATCGCCATCGCAGCTTAATTAGCCATCTGACAGT
ATTGTTCTCAGAAATCCGTCCCTGCCGATGAACAACACACCATCATCGATGTCGAGCCCCTGAGTGTCGCCCCCA
AGGTTGTACCGCCAGAGGATATGCAAATGCCCAACGAATCTCTTGTGCTGTGGTCTGGCGTCACCAAAGCCATAC
ACGCCAAACAATTTTCCAAAGCCACAGCTCTCAAGGTTGAACTCGAGGAAGGCCAGCGCGAAAAGGCCCGGCAGC
GCCTTCAGTCGAGCGAGGAATGGAAACCCGTTTTTTTCGAACATGTCGTTGGTAATGGCGGCAAGCCGGATCTGA
CCCTAAAGGGCAAACAGGTACTCGAGCGTGCCCAACAAGACGATTGGTCCATGGACGGCATCATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail