Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4058
Gene name
LocationContig_325:6711..7943
Strand-
Gene length (bp)1232
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain 3.0E-20 9 145

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870G1|LYS1_EMENI Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lysA PE=3 SV=2 3 383 6.0E-143
sp|P38997|LYS1_YARLI Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS5 PE=3 SV=1 1 383 3.0E-139
sp|Q09694|LYS1_SCHPO Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys3 PE=1 SV=2 5 381 3.0E-132
sp|Q7SFX6|LYS1_NEUCR Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03118 PE=3 SV=1 5 388 1.0E-128
sp|P38998|LYS1_YEAST Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS1 PE=1 SV=3 9 386 1.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870G1|LYS1_EMENI Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lysA PE=3 SV=2 3 383 6.0E-143
sp|P38997|LYS1_YARLI Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS5 PE=3 SV=1 1 383 3.0E-139
sp|Q09694|LYS1_SCHPO Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys3 PE=1 SV=2 5 381 3.0E-132
sp|Q7SFX6|LYS1_NEUCR Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03118 PE=3 SV=1 5 388 1.0E-128
sp|P38998|LYS1_YEAST Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS1 PE=1 SV=3 9 386 1.0E-127
sp|P43065|LYS1_CANAX Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Candida albicans GN=LYS1 PE=3 SV=1 1 381 3.0E-127
sp|Q6FU27|LYS1_CANGA Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS1 PE=3 SV=1 9 374 4.0E-126
sp|Q75BV4|LYS1_ASHGO Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS1 PE=3 SV=1 9 386 3.0E-122
sp|A8E657|AASS_BOVIN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Bos taurus GN=AASS PE=2 SV=1 8 351 6.0E-12
sp|A2VCW9|AASS_RAT Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Rattus norvegicus GN=Aass PE=2 SV=1 8 351 1.0E-11
sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1 21 351 2.0E-11
sp|Q99K67|AASS_MOUSE Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus GN=Aass PE=1 SV=1 8 351 3.0E-11
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5690
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4058 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7907
Ophiocordyceps camponoti-floridani Ophcf2|00559
Ophiocordyceps kimflemingae Ophio5|167
Ophiocordyceps subramaniannii Hirsu2|8592

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4058
MSGYPQILLRAEQKPLEHRSFSPSVIRSLVEAGYPVAVERSSTEADFKRIFEDEEYQAAGATLVPAGEWPNAAPN
TLILGLKEIPEQDFALTNDHISFAHCYKNQGGWQKVLGRFPRGGSVLYDLEFLLDEQGRRVSAFGYHAGFTGAAL
GLKAWAWQLSHSGQALPAVRSFTHGRGYYLDEAELVQQIRSDVEAAERTLGRKPTAMVLGALGRCGKGACDLFIK
AGIPEENLLRWDLDETKNRNGPYEEIVQHDIFLNAIYLSKPIPPFVNDQLLAKPGRKLSVVVDVSCDTTNPHNPI
PIYSINTTFDEPTVPVSVKGDANKSPLSVISIDHLPSMLPREASEAFSQGLRDSLLQLKDRKTWRVWADAEKLFE
EKVSQLPEALRRKE*
Coding >OphauG2|4058
ATGTCCGGGTATCCACAGATTCTGCTACGTGCAGAGCAGAAACCACTGGAGCATCGTTCATTTTCACCGAGTGTC
ATCCGCTCCCTCGTCGAGGCAGGTTACCCCGTGGCAGTTGAGCGATCCTCCACCGAAGCCGATTTCAAGCGCATC
TTTGAAGACGAAGAGTACCAGGCGGCTGGTGCTACACTGGTTCCGGCCGGCGAATGGCCCAATGCTGCGCCCAAT
ACCCTGATACTGGGCCTCAAGGAAATCCCAGAACAAGACTTTGCCCTGACCAATGACCACATCTCATTTGCGCAC
TGCTACAAGAACCAAGGCGGATGGCAAAAGGTTCTTGGCCGATTTCCTCGCGGGGGCTCTGTATTGTACGACCTC
GAGTTCCTCCTTGACGAACAGGGCCGCCGTGTGAGTGCGTTTGGGTACCATGCCGGCTTCACCGGCGCAGCCCTT
GGACTCAAGGCGTGGGCGTGGCAGTTGAGCCACTCGGGCCAGGCTCTCCCTGCCGTCAGAAGCTTCACCCATGGC
AGAGGGTACTATCTAGATGAAGCTGAGCTCGTCCAACAGATACGCTCAGATGTTGAGGCTGCGGAAAGGACGCTG
GGGCGCAAGCCAACTGCCATGGTGCTTGGCGCCTTGGGCCGCTGCGGAAAGGGTGCTTGCGACCTCTTTATCAAG
GCCGGTATACCCGAAGAGAACCTTTTGCGCTGGGATCTAGACGAGACCAAGAATCGCAACGGGCCGTACGAGGAG
ATTGTCCAACACGACATCTTTCTCAATGCTATCTACCTGTCGAAGCCGATTCCGCCTTTTGTCAATGACCAACTC
TTGGCTAAGCCTGGGCGCAAGCTGTCTGTGGTGGTTGACGTATCATGCGACACGACAAACCCACACAATCCTATT
CCGATATACAGTATTAACACGACATTTGACGAGCCAACTGTGCCGGTTAGTGTAAAGGGAGATGCAAACAAGAGC
CCGCTGTCAGTGATTAGCATCGACCATCTGCCGTCGATGCTGCCCCGCGAAGCCAGTGAGGCGTTTAGTCAAGGG
CTGCGCGACTCGCTACTGCAGCTCAAGGACCGCAAGACATGGCGCGTGTGGGCAGATGCTGAGAAGCTGTTTGAG
GAAAAGGTATCGCAGCTGCCCGAGGCTCTAAGGCGCAAGGAATAG
Transcript >OphauG2|4058
ATGTCCGGGTATCCACAGATTCTGCTACGTGCAGAGCAGAAACCACTGGAGCATCGTTCATTTTCACCGAGTGTC
ATCCGCTCCCTCGTCGAGGCAGGTTACCCCGTGGCAGTTGAGCGATCCTCCACCGAAGCCGATTTCAAGCGCATC
TTTGAAGACGAAGAGTACCAGGCGGCTGGTGCTACACTGGTTCCGGCCGGCGAATGGCCCAATGCTGCGCCCAAT
ACCCTGATACTGGGCCTCAAGGAAATCCCAGAACAAGACTTTGCCCTGACCAATGACCACATCTCATTTGCGCAC
TGCTACAAGAACCAAGGCGGATGGCAAAAGGTTCTTGGCCGATTTCCTCGCGGGGGCTCTGTATTGTACGACCTC
GAGTTCCTCCTTGACGAACAGGGCCGCCGTGTGAGTGCGTTTGGGTACCATGCCGGCTTCACCGGCGCAGCCCTT
GGACTCAAGGCGTGGGCGTGGCAGTTGAGCCACTCGGGCCAGGCTCTCCCTGCCGTCAGAAGCTTCACCCATGGC
AGAGGGTACTATCTAGATGAAGCTGAGCTCGTCCAACAGATACGCTCAGATGTTGAGGCTGCGGAAAGGACGCTG
GGGCGCAAGCCAACTGCCATGGTGCTTGGCGCCTTGGGCCGCTGCGGAAAGGGTGCTTGCGACCTCTTTATCAAG
GCCGGTATACCCGAAGAGAACCTTTTGCGCTGGGATCTAGACGAGACCAAGAATCGCAACGGGCCGTACGAGGAG
ATTGTCCAACACGACATCTTTCTCAATGCTATCTACCTGTCGAAGCCGATTCCGCCTTTTGTCAATGACCAACTC
TTGGCTAAGCCTGGGCGCAAGCTGTCTGTGGTGGTTGACGTATCATGCGACACGACAAACCCACACAATCCTATT
CCGATATACAGTATTAACACGACATTTGACGAGCCAACTGTGCCGGTTAGTGTAAAGGGAGATGCAAACAAGAGC
CCGCTGTCAGTGATTAGCATCGACCATCTGCCGTCGATGCTGCCCCGCGAAGCCAGTGAGGCGTTTAGTCAAGGG
CTGCGCGACTCGCTACTGCAGCTCAAGGACCGCAAGACATGGCGCGTGTGGGCAGATGCTGAGAAGCTGTTTGAG
GAAAAGGTATCGCAGCTGCCCGAGGCTCTAAGGCGCAAGGAATAG
Gene >OphauG2|4058
ATGTCCGGGTATCCACAGATTCTGCTACGTGCAGAGCAGAAACCACTGGAGCATCGTTCATTTTCACCGAGTGTC
ATCCGCTCCCTCGTCGAGGCAGGTTACCCCGTGGCAGTTGAGCGATCCTCCACCGAAGCCGATTTCAAGCGCATC
TTTGAAGACGAAGAGTACCAGGCGGCTGGTGCTACACTGGTTCCGGCCGGCGAATGGCCCAATGCTGCGCCCAAT
ACCCTGATACTGGGCCTCAAGGAAATCCCAGAACAAGACTTTGCCCTGACCAATGACCACATCTCATTTGCGCAC
TGCTACAAGAACCAAGGCGGATGGCAAAAGGTTCTTGGCCGATTTCCTCGCGGGGGCTCTGTATTGTACGACCTC
GAGTTCCTCCTTGACGAACAGGGCCGCCGTGTGAGTGCGTTTGGGTACCATGCCGGCTTCACCGGCGCAGCCCTT
GGACTCAAGGCGTGGGCGTGGCAGTTGAGCCACTCGGGCCAGGCTCTCCCTGCCGTCAGAAGCTTCACCCATGGC
AGAGGGTACTATCTAGATGAAGCTGAGCTCGTCCAACAGATACGCTCAGATGTTGAGGCTGCGGAAAGGACGCTG
GGGCGCAAGCCAACTGCCATGGTGCTTGGCGCCTTGGGCCGCTGCGGAAAGGGTGCTTGCGACCTCTTTATCAAG
GCCGGTATACCCGAAGAGAACCTTTTGCGCTGGGATCTAGACGAGACCAAGAATCGCAACGGGCCGTACGAGGAG
ATTGTCCAACACGACATCTTTCTCAATGCTGTAAGTATAGTATTGATAGCAAGGCTGCAGCAGCAAAGTGGATTG
ACTTCAGGGTACACTAGATCTACCTGTCGAAGCCGATTCCGCCTTTTGTCAATGACCAACTCTTGGCTAAGCCTG
GGCGCAAGCTGTCTGTGGTGGTTGACGTATCATGCGACACGACAAACCCACACAATCCTATTCCGATATACAGTA
TTAACACGACATTTGACGAGCCAACTGTGCCGGTTAGTGTAAAGGGAGATGCAAACAAGAGCCCGCTGTCAGTGA
TTAGCATCGACCATCTGCCGTCGATGCTGCCCCGCGAAGCCAGTGAGGCGTTTAGTCAAGGGCTGCGCGACTCGC
TACTGCAGCTCAAGGACCGCAAGACATGGCGCGTGTGGGCAGATGCTGAGAAGCTGTTTGAGGAAAAGGTATCGC
AGCTGCCCGAGGCTCTAAGGCGCAAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail