Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4050
Gene name
LocationContig_324:5751..7351
Strand+
Gene length (bp)1600
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F) 5.2E-86 212 502
PF18553 PheRS_DBD3 PheRS DNA binding domain 3 5.0E-16 77 136
PF18554 PheRS_DBD2 PheRS DNA binding domain 2 5.8E-07 138 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15625|SYFA_YEAST Phenylalanine--tRNA ligase alpha subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS2 PE=1 SV=3 11 512 0.0E+00
sp|O42870|SYFA_SCHPO Phenylalanine--tRNA ligase alpha subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs2 PE=3 SV=3 38 512 0.0E+00
sp|Q7SYV0|SYFAB_XENLA Phenylalanine--tRNA ligase alpha subunit B OS=Xenopus laevis GN=farsa-b PE=2 SV=1 31 510 4.0E-165
sp|Q6AZG6|SYFAA_XENLA Phenylalanine--tRNA ligase alpha subunit A OS=Xenopus laevis GN=farsa-a PE=2 SV=1 31 510 1.0E-164
sp|Q1JPX3|SYFA_DANRE Phenylalanine--tRNA ligase alpha subunit OS=Danio rerio GN=farsa PE=2 SV=2 27 510 9.0E-162
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15625|SYFA_YEAST Phenylalanine--tRNA ligase alpha subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRS2 PE=1 SV=3 11 512 0.0E+00
sp|O42870|SYFA_SCHPO Phenylalanine--tRNA ligase alpha subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frs2 PE=3 SV=3 38 512 0.0E+00
sp|Q7SYV0|SYFAB_XENLA Phenylalanine--tRNA ligase alpha subunit B OS=Xenopus laevis GN=farsa-b PE=2 SV=1 31 510 4.0E-165
sp|Q6AZG6|SYFAA_XENLA Phenylalanine--tRNA ligase alpha subunit A OS=Xenopus laevis GN=farsa-a PE=2 SV=1 31 510 1.0E-164
sp|Q1JPX3|SYFA_DANRE Phenylalanine--tRNA ligase alpha subunit OS=Danio rerio GN=farsa PE=2 SV=2 27 510 9.0E-162
sp|Q505J8|SYFA_RAT Phenylalanine--tRNA ligase alpha subunit OS=Rattus norvegicus GN=Farsa PE=1 SV=1 35 512 1.0E-159
sp|Q8C0C7|SYFA_MOUSE Phenylalanine--tRNA ligase alpha subunit OS=Mus musculus GN=Farsa PE=1 SV=1 35 512 3.0E-158
sp|Q9Y285|SYFA_HUMAN Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens GN=FARSA PE=1 SV=3 10 512 2.0E-155
sp|Q5RFA2|SYFA_PONAB Phenylalanine--tRNA ligase alpha subunit OS=Pongo abelii GN=FARSA PE=2 SV=1 65 512 6.0E-155
sp|Q9W3J5|SYFA_DROME Phenylalanine--tRNA ligase alpha subunit OS=Drosophila melanogaster GN=alpha-PheRS PE=1 SV=1 11 511 8.0E-153
sp|Q9T034|SYFA_ARATH Phenylalanine--tRNA ligase alpha subunit, cytoplasmic OS=Arabidopsis thaliana GN=At4g39280 PE=2 SV=3 34 509 3.0E-151
sp|Q8SRG9|SYFA_ENCCU Probable phenylalanine--tRNA ligase alpha subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_1660 PE=3 SV=1 12 510 4.0E-148
sp|Q54KS8|SYFA_DICDI Phenylalanine--tRNA ligase alpha subunit OS=Dictyostelium discoideum GN=phesA PE=3 SV=1 38 512 6.0E-140
sp|C4V6K5|SYFA_NOSCE Probable phenylalanine--tRNA ligase alpha subunit OS=Nosema ceranae (strain BRL01) GN=NCER_100038 PE=3 SV=1 12 503 2.0E-135
sp|Q5ZJQ2|SYFA_CHICK Phenylalanine--tRNA ligase alpha subunit OS=Gallus gallus GN=FARSA PE=1 SV=1 4 453 8.0E-122
sp|B7XI98|SYFA_ENTBH Probable phenylalanine--tRNA ligase alpha subunit OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22775 PE=3 SV=1 16 511 8.0E-121
sp|Q0W0X9|SYFA_METAR Phenylalanine--tRNA ligase alpha subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pheS PE=3 SV=1 36 507 4.0E-79
sp|O28324|SYFA_ARCFU Phenylalanine--tRNA ligase alpha subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pheS PE=3 SV=1 65 508 4.0E-77
sp|Q57911|SYFA_METJA Phenylalanine--tRNA ligase alpha subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pheS PE=3 SV=1 67 503 5.0E-74
sp|Q979U4|SYFA_THEVO Phenylalanine--tRNA ligase alpha subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pheS PE=3 SV=1 35 502 1.0E-73
sp|Q8TYM5|SYFA_METKA Phenylalanine--tRNA ligase alpha subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pheS PE=3 SV=1 192 508 1.0E-71
sp|A2ST81|SYFA_METLZ Phenylalanine--tRNA ligase alpha subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pheS PE=3 SV=1 47 508 6.0E-71
sp|P57693|SYFA_THEAC Phenylalanine--tRNA ligase alpha subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pheS PE=3 SV=1 16 501 2.0E-69
sp|Q6LX56|SYFA_METMP Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=pheS PE=3 SV=1 76 503 1.0E-68
sp|A3CT76|SYFA_METMJ Phenylalanine--tRNA ligase alpha subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pheS PE=3 SV=1 125 506 1.0E-68
sp|A6VH81|SYFA_METM7 Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pheS PE=3 SV=1 90 503 2.0E-67
sp|Q9HMK4|SYFA_HALSA Phenylalanine--tRNA ligase alpha subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pheS PE=3 SV=1 185 507 2.0E-66
sp|B0R806|SYFA_HALS3 Phenylalanine--tRNA ligase alpha subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pheS PE=3 SV=1 185 507 2.0E-66
sp|A6UQD9|SYFA_METVS Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pheS PE=3 SV=1 21 507 8.0E-66
sp|Q8PWV6|SYFA_METMA Phenylalanine--tRNA ligase alpha subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pheS PE=3 SV=1 65 509 3.0E-65
sp|Q2FLL0|SYFA_METHJ Phenylalanine--tRNA ligase alpha subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pheS PE=3 SV=1 102 508 8.0E-65
sp|O26837|SYFA_METTH Phenylalanine--tRNA ligase alpha subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pheS PE=1 SV=1 35 506 8.0E-65
sp|A4FW27|SYFA_METM5 Phenylalanine--tRNA ligase alpha subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pheS PE=3 SV=1 154 503 5.0E-64
sp|Q9UYX3|SYFA_PYRAB Phenylalanine--tRNA ligase alpha subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pheS PE=3 SV=1 150 501 5.0E-64
sp|Q8TUA2|SYFA_METAC Phenylalanine--tRNA ligase alpha subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pheS PE=3 SV=1 53 509 4.0E-63
sp|Q46CQ6|SYFA_METBF Phenylalanine--tRNA ligase alpha subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pheS PE=3 SV=1 153 508 6.0E-63
sp|O58391|SYFA_PYRHO Phenylalanine--tRNA ligase alpha subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pheS PE=3 SV=1 76 507 8.0E-63
sp|Q8U261|SYFA_PYRFU Phenylalanine--tRNA ligase alpha subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pheS PE=3 SV=1 158 501 1.0E-62
sp|B6YTJ4|SYFA_THEON Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus onnurineus (strain NA1) GN=pheS PE=3 SV=1 73 501 5.0E-62
sp|Q76KA8|SYFA_THEKO Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pheS PE=1 SV=1 73 501 4.0E-60
sp|C5A5Y9|SYFA_THEGJ Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pheS PE=3 SV=1 73 501 8.0E-59
sp|P95961|SYFA_SULSO Phenylalanine--tRNA ligase alpha subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pheS PE=3 SV=2 125 497 3.0E-58
sp|A4YIL1|SYFA_METS5 Phenylalanine--tRNA ligase alpha subunit OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pheS PE=3 SV=1 18 501 8.0E-57
sp|A3MUA4|SYFA_PYRCJ Phenylalanine--tRNA ligase alpha subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pheS PE=3 SV=1 41 497 2.0E-56
sp|C6A236|SYFA_THESM Phenylalanine--tRNA ligase alpha subunit OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pheS PE=3 SV=1 69 501 7.0E-56
sp|Q8ZX61|SYFA_PYRAE Phenylalanine--tRNA ligase alpha subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pheS PE=3 SV=1 96 492 1.0E-55
sp|Q9Y9I6|SYFA_AERPE Phenylalanine--tRNA ligase alpha subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pheS PE=3 SV=2 94 497 2.0E-54
sp|Q971D7|SYFA_SULTO Phenylalanine--tRNA ligase alpha subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pheS PE=3 SV=1 153 510 3.0E-54
sp|Q4J8P9|SYFA_SULAC Phenylalanine--tRNA ligase alpha subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pheS PE=3 SV=1 152 509 1.0E-52
sp|P94282|SYFA_BORBU Phenylalanine--tRNA ligase alpha subunit OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pheS PE=3 SV=2 190 496 1.0E-52
sp|A4WHY5|SYFA_PYRAR Phenylalanine--tRNA ligase alpha subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pheS PE=3 SV=1 191 492 9.0E-52
sp|B2S4L0|SYFA_TREPS Phenylalanine--tRNA ligase alpha subunit OS=Treponema pallidum subsp. pallidum (strain SS14) GN=pheS PE=3 SV=1 194 497 2.0E-45
sp|O83938|SYFA_TREPA Phenylalanine--tRNA ligase alpha subunit OS=Treponema pallidum (strain Nichols) GN=pheS PE=3 SV=1 194 497 2.0E-45
sp|Q5M3S5|SYFA_STRT2 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pheS PE=3 SV=2 218 503 2.0E-34
sp|Q5LZ70|SYFA_STRT1 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pheS PE=3 SV=2 218 503 2.0E-34
sp|Q03K19|SYFA_STRTD Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=pheS PE=3 SV=1 218 489 4.0E-34
sp|Q72HA1|SYFA_THET2 Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pheS PE=3 SV=1 218 507 5.0E-33
sp|Q8CWX1|SYFA_STRMU Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pheS PE=3 SV=1 218 489 6.0E-33
sp|Q836J6|SYFA_ENTFA Phenylalanine--tRNA ligase alpha subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pheS PE=3 SV=1 218 503 9.0E-33
sp|A4XKJ8|SYFA_CALS8 Phenylalanine--tRNA ligase alpha subunit OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pheS PE=3 SV=1 218 503 2.0E-32
sp|B9MRS9|SYFA_CALBD Phenylalanine--tRNA ligase alpha subunit OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pheS PE=3 SV=1 218 503 2.0E-32
sp|Q9CEB4|SYFA_LACLA Phenylalanine--tRNA ligase alpha subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pheS PE=3 SV=1 218 503 3.0E-32
sp|A6TNP8|SYFA_ALKMQ Phenylalanine--tRNA ligase alpha subunit OS=Alkaliphilus metalliredigens (strain QYMF) GN=pheS PE=3 SV=1 148 503 3.0E-32
sp|P27001|SYFA_THETH Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus GN=pheS PE=1 SV=1 218 507 5.0E-32
sp|Q5SGX2|SYFA_THET8 Phenylalanine--tRNA ligase alpha subunit OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pheS PE=1 SV=1 218 507 5.0E-32
sp|Q67QF3|SYFA_SYMTH Phenylalanine--tRNA ligase alpha subunit OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pheS PE=3 SV=1 218 501 6.0E-32
sp|Q11Q26|SYFA_CYTH3 Phenylalanine--tRNA ligase alpha subunit OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pheS PE=3 SV=1 95 489 7.0E-32
sp|Q8R9C6|SYFA_CALS4 Phenylalanine--tRNA ligase alpha subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pheS PE=3 SV=1 210 503 7.0E-32
sp|Q7TTU6|SYFA_SYNPX Phenylalanine--tRNA ligase alpha subunit OS=Synechococcus sp. (strain WH8102) GN=pheS PE=3 SV=1 224 503 7.0E-32
sp|Q02WL3|SYFA_LACLS Phenylalanine--tRNA ligase alpha subunit OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=pheS PE=3 SV=1 218 503 1.0E-31
sp|A2RN75|SYFA_LACLM Phenylalanine--tRNA ligase alpha subunit OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pheS PE=3 SV=1 218 503 1.0E-31
sp|Q73IM5|SYFA_WOLPM Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia pipientis wMel GN=pheS PE=3 SV=1 221 496 2.0E-31
sp|C0R5D1|SYFA_WOLWR Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=pheS PE=3 SV=1 221 496 2.0E-31
sp|Q7TV42|SYFA_PROMM Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain MIT 9313) GN=pheS PE=3 SV=1 175 503 2.0E-31
sp|C0MH11|SYFA_STRS7 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pheS PE=3 SV=1 218 489 2.0E-31
sp|C0M7G8|SYFA_STRE4 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus equi subsp. equi (strain 4047) GN=pheS PE=3 SV=1 218 489 2.0E-31
sp|B4U2E8|SYFA_STREM Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=pheS PE=3 SV=1 218 489 2.0E-31
sp|Q7VAV9|SYFA_PROMA Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=pheS PE=3 SV=1 224 503 3.0E-31
sp|B0TEV9|SYFA_HELMI Phenylalanine--tRNA ligase alpha subunit OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=pheS PE=3 SV=1 218 501 4.0E-31
sp|Q319M1|SYFA_PROM9 Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain MIT 9312) GN=pheS PE=3 SV=1 224 503 4.0E-31
sp|A8ZZ70|SYFA_DESOH Phenylalanine--tRNA ligase alpha subunit OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=pheS PE=3 SV=1 218 492 4.0E-31
sp|Q2LR28|SYFA_SYNAS Phenylalanine--tRNA ligase alpha subunit OS=Syntrophus aciditrophicus (strain SB) GN=pheS PE=3 SV=1 218 489 5.0E-31
sp|Q9A0I1|SYFA_STRP1 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M1 GN=pheS PE=3 SV=2 218 489 5.0E-31
sp|B3Q5X1|SYFA_RHOPT Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain TIE-1) GN=pheS PE=3 SV=1 224 492 5.0E-31
sp|Q6NDR7|SYFA_RHOPA Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pheS PE=3 SV=1 224 492 5.0E-31
sp|B5XKQ6|SYFA_STRPZ Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=pheS PE=3 SV=1 218 489 5.0E-31
sp|P0DG51|SYFA_STRPQ Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pheS PE=3 SV=1 218 489 5.0E-31
sp|Q5XCX4|SYFA_STRP6 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pheS PE=3 SV=2 218 489 5.0E-31
sp|P0DG50|SYFA_STRP3 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pheS PE=3 SV=1 218 489 5.0E-31
sp|B9DRU2|SYFA_STRU0 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=pheS PE=3 SV=1 218 503 5.0E-31
sp|A0L4K0|SYFA_MAGMM Phenylalanine--tRNA ligase alpha subunit OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=pheS PE=3 SV=1 218 504 6.0E-31
sp|A4YJN0|SYFA_BRASO Phenylalanine--tRNA ligase alpha subunit OS=Bradyrhizobium sp. (strain ORS278) GN=pheS PE=3 SV=1 222 492 6.0E-31
sp|A0LFC6|SYFA_SYNFM Phenylalanine--tRNA ligase alpha subunit OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pheS PE=3 SV=1 143 489 7.0E-31
sp|A8MI78|SYFA_ALKOO Phenylalanine--tRNA ligase alpha subunit OS=Alkaliphilus oremlandii (strain OhILAs) GN=pheS PE=3 SV=1 224 503 8.0E-31
sp|Q1QS22|SYFA_NITHX Phenylalanine--tRNA ligase alpha subunit OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pheS PE=3 SV=1 219 492 1.0E-30
sp|Q8E066|SYFA_STRA5 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pheS PE=3 SV=1 218 489 1.0E-30
sp|Q3K1I9|SYFA_STRA1 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pheS PE=3 SV=1 218 489 1.0E-30
sp|A4IRM4|SYFA_GEOTN Phenylalanine--tRNA ligase alpha subunit OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pheS PE=3 SV=1 218 503 1.0E-30
sp|Q8E5U3|SYFA_STRA3 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pheS PE=3 SV=1 218 489 1.0E-30
sp|Q2SSA0|SYFA_MYCCT Phenylalanine--tRNA ligase alpha subunit OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=pheS PE=3 SV=1 95 503 2.0E-30
sp|A8FG17|SYFA_BACP2 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus pumilus (strain SAFR-032) GN=pheS PE=3 SV=1 224 499 2.0E-30
sp|A3DBX6|SYFA_CLOTH Phenylalanine--tRNA ligase alpha subunit OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=pheS PE=3 SV=1 218 503 2.0E-30
sp|Q0SRU1|SYFA_CLOPS Phenylalanine--tRNA ligase alpha subunit OS=Clostridium perfringens (strain SM101 / Type A) GN=pheS PE=3 SV=1 218 503 2.0E-30
sp|Q55187|SYFA_SYNY3 Phenylalanine--tRNA ligase alpha subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pheS PE=3 SV=1 218 503 3.0E-30
sp|A7HLU6|SYFA_FERNB Phenylalanine--tRNA ligase alpha subunit OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pheS PE=3 SV=1 86 502 3.0E-30
sp|Q8XJ75|SYFA_CLOPE Phenylalanine--tRNA ligase alpha subunit OS=Clostridium perfringens (strain 13 / Type A) GN=pheS PE=3 SV=1 218 503 3.0E-30
sp|A9BFH2|SYFA_PETMO Phenylalanine--tRNA ligase alpha subunit OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=pheS PE=3 SV=1 218 504 3.0E-30
sp|Q0TP72|SYFA_CLOP1 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pheS PE=3 SV=1 218 503 3.0E-30
sp|A5E8L7|SYFA_BRASB Phenylalanine--tRNA ligase alpha subunit OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pheS PE=3 SV=1 219 492 3.0E-30
sp|Q5KWE4|SYFA_GEOKA Phenylalanine--tRNA ligase alpha subunit OS=Geobacillus kaustophilus (strain HTA426) GN=pheS PE=3 SV=1 218 501 3.0E-30
sp|C5D627|SYFA_GEOSW Phenylalanine--tRNA ligase alpha subunit OS=Geobacillus sp. (strain WCH70) GN=pheS PE=3 SV=1 224 503 3.0E-30
sp|Q8FXX5|SYFA_BRUSU Phenylalanine--tRNA ligase alpha subunit OS=Brucella suis biovar 1 (strain 1330) GN=pheS PE=3 SV=1 219 502 4.0E-30
sp|B0CJX0|SYFA_BRUSI Phenylalanine--tRNA ligase alpha subunit OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pheS PE=3 SV=1 219 502 4.0E-30
sp|C0RG06|SYFA_BRUMB Phenylalanine--tRNA ligase alpha subunit OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pheS PE=3 SV=1 219 502 4.0E-30
sp|Q57AE0|SYFA_BRUAB Phenylalanine--tRNA ligase alpha subunit OS=Brucella abortus biovar 1 (strain 9-941) GN=pheS PE=3 SV=1 219 502 4.0E-30
sp|Q2YQV5|SYFA_BRUA2 Phenylalanine--tRNA ligase alpha subunit OS=Brucella abortus (strain 2308) GN=pheS PE=3 SV=1 219 502 4.0E-30
sp|B2S9B8|SYFA_BRUA1 Phenylalanine--tRNA ligase alpha subunit OS=Brucella abortus (strain S19) GN=pheS PE=3 SV=1 219 502 4.0E-30
sp|A6WX16|SYFA_OCHA4 Phenylalanine--tRNA ligase alpha subunit OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pheS PE=3 SV=1 224 502 4.0E-30
sp|Q9CC17|SYFA_MYCLE Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium leprae (strain TN) GN=pheS PE=3 SV=2 221 500 5.0E-30
sp|Q89WI1|SYFA_BRADU Phenylalanine--tRNA ligase alpha subunit OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pheS PE=3 SV=1 222 496 5.0E-30
sp|Q47CM8|SYFA_DECAR Phenylalanine--tRNA ligase alpha subunit OS=Dechloromonas aromatica (strain RCB) GN=pheS PE=3 SV=1 218 503 5.0E-30
sp|B1VA93|SYFA_PHYAS Phenylalanine--tRNA ligase alpha subunit OS=Phytoplasma australiense GN=pheS PE=3 SV=1 149 503 5.0E-30
sp|A9VJM4|SYFA_BACWK Phenylalanine--tRNA ligase alpha subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=pheS PE=3 SV=1 218 503 5.0E-30
sp|Q21C64|SYFA_RHOPB Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain BisB18) GN=pheS PE=3 SV=1 224 492 6.0E-30
sp|Q8P1K1|SYFA_STRP8 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pheS PE=3 SV=2 218 489 8.0E-30
sp|Q1MRV5|SYFA_LAWIP Phenylalanine--tRNA ligase alpha subunit OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=pheS PE=3 SV=1 184 503 9.0E-30
sp|Q7V0I7|SYFA_PROMP Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=pheS PE=3 SV=1 224 503 1.0E-29
sp|Q4L5E3|SYFA_STAHJ Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pheS PE=1 SV=1 224 507 1.0E-29
sp|Q46JK1|SYFA_PROMT Phenylalanine--tRNA ligase alpha subunit OS=Prochlorococcus marinus (strain NATL2A) GN=pheS PE=3 SV=1 224 503 1.0E-29
sp|A5N254|SYFA_CLOK5 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pheS PE=3 SV=1 218 501 1.0E-29
sp|A5VT73|SYFA_BRUO2 Phenylalanine--tRNA ligase alpha subunit OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pheS PE=3 SV=1 219 502 1.0E-29
sp|Q8YE73|SYFA_BRUME Phenylalanine--tRNA ligase alpha subunit OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pheS PE=3 SV=1 219 502 1.0E-29
sp|B7GGW8|SYFA_ANOFW Phenylalanine--tRNA ligase alpha subunit OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pheS PE=3 SV=1 224 503 1.0E-29
sp|Q5NMC2|SYFA_ZYMMO Phenylalanine--tRNA ligase alpha subunit OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pheS PE=3 SV=1 224 489 1.0E-29
sp|A1TAB5|SYFA_MYCVP Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pheS PE=3 SV=1 221 500 2.0E-29
sp|A4T9V2|SYFA_MYCGI Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium gilvum (strain PYR-GCK) GN=pheS PE=3 SV=1 221 500 2.0E-29
sp|P17921|SYFA_BACSU Phenylalanine--tRNA ligase alpha subunit OS=Bacillus subtilis (strain 168) GN=pheS PE=3 SV=2 218 501 2.0E-29
sp|Q6HCW7|SYFA_BACHK Phenylalanine--tRNA ligase alpha subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|Q633N4|SYFA_BACCZ Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain ZK / E33L) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|Q817I6|SYFA_BACCR Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|B9J063|SYFA_BACCQ Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain Q1) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|B7HRK2|SYFA_BACC7 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain AH187) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|B7HF77|SYFA_BACC4 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain B4264) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|C1EU00|SYFA_BACC3 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain 03BB102) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|B7IJW0|SYFA_BACC2 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain G9842) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|Q72ZI1|SYFA_BACC1 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|B7JR67|SYFA_BACC0 Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cereus (strain AH820) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|Q81L30|SYFA_BACAN Phenylalanine--tRNA ligase alpha subunit OS=Bacillus anthracis GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|C3L8T8|SYFA_BACAC Phenylalanine--tRNA ligase alpha subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|C3PAE9|SYFA_BACAA Phenylalanine--tRNA ligase alpha subunit OS=Bacillus anthracis (strain A0248) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|Q6ANC1|SYFA_DESPS Phenylalanine--tRNA ligase alpha subunit OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pheS PE=3 SV=1 218 489 2.0E-29
sp|Q1GZS1|SYFA_METFK Phenylalanine--tRNA ligase alpha subunit OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pheS PE=3 SV=1 221 503 2.0E-29
sp|B9DPU8|SYFA_STACT Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus carnosus (strain TM300) GN=pheS PE=3 SV=1 224 507 2.0E-29
sp|C3PNE3|SYFA_RICAE Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia africae (strain ESF-5) GN=pheS PE=3 SV=1 224 492 2.0E-29
sp|B6J7X7|SYFA_COXB1 Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain CbuK_Q154) GN=pheS PE=3 SV=1 218 501 2.0E-29
sp|Q83C14|SYFA_COXBU Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pheS PE=3 SV=1 218 501 2.0E-29
sp|A9N8K1|SYFA_COXBR Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pheS PE=3 SV=1 218 501 2.0E-29
sp|A9KGB7|SYFA_COXBN Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pheS PE=3 SV=1 218 501 2.0E-29
sp|A7GTL0|SYFA_BACCN Phenylalanine--tRNA ligase alpha subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pheS PE=3 SV=1 218 503 2.0E-29
sp|B3EKG5|SYFA_CHLPB Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium phaeobacteroides (strain BS1) GN=pheS PE=3 SV=1 176 496 2.0E-29
sp|B8FFU3|SYFA_DESAA Phenylalanine--tRNA ligase alpha subunit OS=Desulfatibacillum alkenivorans (strain AK-01) GN=pheS PE=3 SV=1 146 503 2.0E-29
sp|B6IZG0|SYFA_COXB2 Phenylalanine--tRNA ligase alpha subunit OS=Coxiella burnetii (strain CbuG_Q212) GN=pheS PE=3 SV=1 218 501 3.0E-29
sp|A4J4Z4|SYFA_DESRM Phenylalanine--tRNA ligase alpha subunit OS=Desulfotomaculum reducens (strain MI-1) GN=pheS PE=3 SV=1 218 501 3.0E-29
sp|B3CMZ6|SYFA_WOLPP Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=pheS PE=3 SV=1 221 496 3.0E-29
sp|C1CCV6|SYFA_STRZJ Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain JJA) GN=pheS PE=3 SV=1 223 489 3.0E-29
sp|B8ESQ6|SYFA_METSB Phenylalanine--tRNA ligase alpha subunit OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=pheS PE=3 SV=1 223 489 3.0E-29
sp|B6JCK5|SYFA_OLICO Phenylalanine--tRNA ligase alpha subunit OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pheS PE=3 SV=1 224 492 3.0E-29
sp|B8G0L8|SYFA_DESHD Phenylalanine--tRNA ligase alpha subunit OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pheS PE=3 SV=1 136 503 4.0E-29
sp|Q63TM6|SYFA_BURPS Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia pseudomallei (strain K96243) GN=pheS PE=3 SV=1 218 503 4.0E-29
sp|Q3JT08|SYFA_BURP1 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia pseudomallei (strain 1710b) GN=pheS PE=3 SV=1 218 503 4.0E-29
sp|Q62KI6|SYFA_BURMA Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia mallei (strain ATCC 23344) GN=pheS PE=3 SV=1 218 503 4.0E-29
sp|A3MJU2|SYFA_BURM7 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia mallei (strain NCTC 10247) GN=pheS PE=3 SV=1 218 503 4.0E-29
sp|Q2SVE2|SYFA_BURTA Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pheS PE=3 SV=1 218 501 5.0E-29
sp|C4ZBJ4|SYFA_EUBR3 Phenylalanine--tRNA ligase alpha subunit OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=pheS PE=3 SV=1 224 492 5.0E-29
sp|Q5HQ36|SYFA_STAEQ Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pheS PE=3 SV=1 224 507 5.0E-29
sp|Q3B6M2|SYFA_CHLL7 Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pheS PE=3 SV=1 218 506 5.0E-29
sp|Q1RIS9|SYFA_RICBR Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia bellii (strain RML369-C) GN=pheS PE=3 SV=1 224 492 6.0E-29
sp|A8GWH2|SYFA_RICB8 Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia bellii (strain OSU 85-389) GN=pheS PE=3 SV=1 224 492 6.0E-29
sp|Q8CSY9|SYFA_STAES Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pheS PE=3 SV=1 224 507 8.0E-29
sp|A3NUI8|SYFA_BURP0 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia pseudomallei (strain 1106a) GN=pheS PE=3 SV=1 218 503 8.0E-29
sp|B8J4E0|SYFA_DESDA Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pheS PE=3 SV=1 223 496 8.0E-29
sp|Q4ULS5|SYFA_RICFE Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=pheS PE=3 SV=2 224 492 8.0E-29
sp|B9E766|SYFA_MACCJ Phenylalanine--tRNA ligase alpha subunit OS=Macrococcus caseolyticus (strain JCSC5402) GN=pheS PE=3 SV=1 137 501 8.0E-29
sp|B9KAE8|SYFA_THENN Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=pheS PE=3 SV=1 218 496 9.0E-29
sp|A8Z6A5|SYFA_SULMW Phenylalanine--tRNA ligase alpha subunit OS=Sulcia muelleri (strain GWSS) GN=pheS PE=3 SV=1 218 503 9.0E-29
sp|Q891T7|SYFA_CLOTE Phenylalanine--tRNA ligase alpha subunit OS=Clostridium tetani (strain Massachusetts / E88) GN=pheS PE=3 SV=1 218 503 9.0E-29
sp|C4K2A1|SYFA_RICPU Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia peacockii (strain Rustic) GN=pheS PE=3 SV=1 224 492 1.0E-28
sp|Q92I39|SYFA_RICCN Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=pheS PE=3 SV=1 224 492 1.0E-28
sp|A8GS12|SYFA_RICRS Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia rickettsii (strain Sheila Smith) GN=pheS PE=3 SV=1 224 492 1.0E-28
sp|Q7UP75|SYFA_RHOBA Phenylalanine--tRNA ligase alpha subunit OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pheS PE=3 SV=1 218 503 1.0E-28
sp|B5EBY3|SYFA_GEOBB Phenylalanine--tRNA ligase alpha subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=pheS PE=3 SV=1 218 503 1.0E-28
sp|A8EZ06|SYFA_RICCK Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia canadensis (strain McKiel) GN=pheS PE=3 SV=1 224 492 1.0E-28
sp|Q251I2|SYFA_DESHY Phenylalanine--tRNA ligase alpha subunit OS=Desulfitobacterium hafniense (strain Y51) GN=pheS PE=3 SV=1 136 503 1.0E-28
sp|Q13ET5|SYFA_RHOPS Phenylalanine--tRNA ligase alpha subunit OS=Rhodopseudomonas palustris (strain BisB5) GN=pheS PE=3 SV=1 224 492 1.0E-28
sp|B4S3C8|SYFA_PROA2 Phenylalanine--tRNA ligase alpha subunit OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=pheS PE=3 SV=1 224 496 1.0E-28
sp|A4JDU8|SYFA_BURVG Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pheS PE=3 SV=1 218 501 1.0E-28
sp|C6DYJ1|SYFA_GEOSM Phenylalanine--tRNA ligase alpha subunit OS=Geobacter sp. (strain M21) GN=pheS PE=3 SV=1 218 503 1.0E-28
sp|Q97S36|SYFA_STRPN Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pheS PE=3 SV=1 224 503 1.0E-28
sp|C1C5V0|SYFA_STRP7 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain 70585) GN=pheS PE=3 SV=1 224 503 1.0E-28
sp|B2IUA1|SYFA_NOSP7 Phenylalanine--tRNA ligase alpha subunit OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pheS PE=3 SV=1 224 503 1.0E-28
sp|Q8DQT8|SYFA_STRR6 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pheS PE=3 SV=2 224 503 1.0E-28
sp|B1IAA1|SYFA_STRPI Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pheS PE=3 SV=1 224 503 1.0E-28
sp|Q04LU1|SYFA_STRP2 Phenylalanine--tRNA ligase alpha subunit OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pheS PE=3 SV=1 224 503 1.0E-28
sp|B4E7I9|SYFA_BURCJ Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pheS PE=3 SV=1 218 501 2.0E-28
sp|A1UUA8|SYFA_BARBK Phenylalanine--tRNA ligase alpha subunit OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pheS PE=3 SV=1 135 489 2.0E-28
sp|Q3SWK7|SYFA_NITWN Phenylalanine--tRNA ligase alpha subunit OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pheS PE=3 SV=1 223 492 2.0E-28
sp|Q8EPH4|SYFA_OCEIH Phenylalanine--tRNA ligase alpha subunit OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pheS PE=3 SV=1 218 501 2.0E-28
sp|Q49WQ5|SYFA_STAS1 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pheS PE=3 SV=1 224 507 2.0E-28
sp|Q65GD2|SYFA_BACLD Phenylalanine--tRNA ligase alpha subunit OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pheS PE=3 SV=1 218 496 2.0E-28
sp|B9JYN0|SYFA_AGRVS Phenylalanine--tRNA ligase alpha subunit OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pheS PE=3 SV=1 224 496 2.0E-28
sp|A5V922|SYFA_SPHWW Phenylalanine--tRNA ligase alpha subunit OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=pheS PE=3 SV=1 224 489 2.0E-28
sp|Q39H51|SYFA_BURL3 Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pheS PE=3 SV=1 218 503 2.0E-28
sp|A5IAL3|SYFA_LEGPC Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila (strain Corby) GN=pheS PE=3 SV=1 218 503 2.0E-28
sp|Q9K895|SYFA_BACHD Phenylalanine--tRNA ligase alpha subunit OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pheS PE=3 SV=1 224 491 3.0E-28
sp|A9M9V4|SYFA_BRUC2 Phenylalanine--tRNA ligase alpha subunit OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pheS PE=3 SV=1 219 502 3.0E-28
sp|Q5WT86|SYFA_LEGPL Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila (strain Lens) GN=pheS PE=3 SV=1 218 503 3.0E-28
sp|A9KHY1|SYFA_CLOPH Phenylalanine--tRNA ligase alpha subunit OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=pheS PE=3 SV=1 224 503 3.0E-28
sp|B2SZF8|SYFA_BURPP Phenylalanine--tRNA ligase alpha subunit OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=pheS PE=3 SV=1 218 503 3.0E-28
sp|Q5X1H7|SYFA_LEGPA Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila (strain Paris) GN=pheS PE=3 SV=1 218 503 3.0E-28
sp|Q2RHN7|SYFA_MOOTA Phenylalanine--tRNA ligase alpha subunit OS=Moorella thermoacetica (strain ATCC 39073) GN=pheS PE=3 SV=1 218 501 4.0E-28
sp|A6GVW9|SYFA_FLAPJ Phenylalanine--tRNA ligase alpha subunit OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pheS PE=3 SV=1 157 503 4.0E-28
sp|Q1D6E0|SYFA_MYXXD Phenylalanine--tRNA ligase alpha subunit OS=Myxococcus xanthus (strain DK 1622) GN=pheS PE=3 SV=1 224 503 4.0E-28
sp|B1I4I5|SYFA_DESAP Phenylalanine--tRNA ligase alpha subunit OS=Desulforudis audaxviator (strain MP104C) GN=pheS PE=3 SV=1 224 501 4.0E-28
sp|B0C6I2|SYFA_ACAM1 Phenylalanine--tRNA ligase alpha subunit OS=Acaryochloris marina (strain MBIC 11017) GN=pheS PE=3 SV=1 224 503 4.0E-28
sp|Q5ZS08|SYFA_LEGPH Phenylalanine--tRNA ligase alpha subunit OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pheS PE=3 SV=1 218 503 4.0E-28
sp|Q2YX87|SYFA_STAAB Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|P68850|SYFA_STAAW Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain MW2) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|P68849|SYFA_STAAU Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|Q6GA76|SYFA_STAAS Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain MSSA476) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|Q6GHU7|SYFA_STAAR Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain MRSA252) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|P68848|SYFA_STAAN Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain N315) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|P68847|SYFA_STAAM Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|A5IS24|SYFA_STAA9 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain JH9) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|A6U0V5|SYFA_STAA2 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain JH1) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|A7X160|SYFA_STAA1 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pheS PE=3 SV=1 224 507 5.0E-28
sp|Q68WW2|SYFA_RICTY Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=pheS PE=3 SV=1 224 492 5.0E-28
sp|A8GND9|SYFA_RICAH Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia akari (strain Hartford) GN=pheS PE=3 SV=1 224 492 5.0E-28
sp|A8Z1R9|SYFA_STAAT Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pheS PE=3 SV=1 224 507 6.0E-28
sp|A6QG39|SYFA_STAAE Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain Newman) GN=pheS PE=3 SV=1 224 507 6.0E-28
sp|Q5HGU6|SYFA_STAAC Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain COL) GN=pheS PE=3 SV=1 224 507 6.0E-28
sp|Q2FZD9|SYFA_STAA8 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain NCTC 8325) GN=pheS PE=3 SV=1 224 507 6.0E-28
sp|Q2FHU3|SYFA_STAA3 Phenylalanine--tRNA ligase alpha subunit OS=Staphylococcus aureus (strain USA300) GN=pheS PE=3 SV=1 224 507 6.0E-28
sp|B2A5N5|SYFA_NATTJ Phenylalanine--tRNA ligase alpha subunit OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pheS PE=3 SV=1 224 489 6.0E-28
sp|B9M520|SYFA_GEODF Phenylalanine--tRNA ligase alpha subunit OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pheS PE=3 SV=1 130 503 6.0E-28
sp|B4RS43|SYFA_ALTMD Phenylalanine--tRNA ligase alpha subunit OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pheS PE=3 SV=1 218 503 7.0E-28
sp|Q3ABT4|SYFA_CARHZ Phenylalanine--tRNA ligase alpha subunit OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pheS PE=3 SV=1 218 502 7.0E-28
sp|Q3J5M4|SYFA_RHOS4 Phenylalanine--tRNA ligase alpha subunit OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pheS PE=3 SV=1 218 489 8.0E-28
sp|A3PGQ9|SYFA_RHOS1 Phenylalanine--tRNA ligase alpha subunit OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pheS PE=3 SV=1 218 489 8.0E-28
sp|Q1MMP3|SYFA_RHIL3 Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pheS PE=3 SV=1 224 496 8.0E-28
sp|Q28V93|SYFA_JANSC Phenylalanine--tRNA ligase alpha subunit OS=Jannaschia sp. (strain CCS1) GN=pheS PE=3 SV=1 221 492 9.0E-28
sp|Q92ST0|SYFA_RHIME Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium meliloti (strain 1021) GN=pheS PE=3 SV=1 224 496 9.0E-28
sp|P9WFU3|SYFA_MYCTU Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pheS PE=1 SV=1 223 500 1.0E-27
sp|P9WFU2|SYFA_MYCTO Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pheS PE=3 SV=1 223 500 1.0E-27
sp|A5U306|SYFA_MYCTA Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pheS PE=3 SV=1 223 500 1.0E-27
sp|C1ANS2|SYFA_MYCBT Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pheS PE=3 SV=1 223 500 1.0E-27
sp|A1KJ66|SYFA_MYCBP Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pheS PE=3 SV=1 223 500 1.0E-27
sp|Q7VEV4|SYFA_MYCBO Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pheS PE=3 SV=1 223 500 1.0E-27
sp|A0QHB6|SYFA_MYCA1 Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium avium (strain 104) GN=pheS PE=3 SV=1 221 492 1.0E-27
sp|C4L450|SYFA_EXISA Phenylalanine--tRNA ligase alpha subunit OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=pheS PE=3 SV=1 218 503 1.0E-27
sp|A6UF74|SYFA_SINMW Phenylalanine--tRNA ligase alpha subunit OS=Sinorhizobium medicae (strain WSM419) GN=pheS PE=3 SV=1 224 496 1.0E-27
sp|Q740J1|SYFA_MYCPA Phenylalanine--tRNA ligase alpha subunit OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pheS PE=3 SV=1 221 492 1.0E-27
sp|Q2NJZ3|SYFA_AYWBP Phenylalanine--tRNA ligase alpha subunit OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=pheS PE=3 SV=1 187 503 1.0E-27
sp|B9KLE0|SYFA_RHOSK Phenylalanine--tRNA ligase alpha subunit OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pheS PE=3 SV=1 218 489 2.0E-27
sp|Q8UIN5|SYFA_AGRFC Phenylalanine--tRNA ligase alpha subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pheS PE=3 SV=1 224 496 2.0E-27
sp|Q9ZDB5|SYFA_RICPR Phenylalanine--tRNA ligase alpha subunit OS=Rickettsia prowazekii (strain Madrid E) GN=pheS PE=3 SV=1 224 492 2.0E-27
sp|B0SJ52|SYFA_LEPBP Phenylalanine--tRNA ligase alpha subunit OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pheS PE=3 SV=1 224 489 2.0E-27
sp|B0SBK8|SYFA_LEPBA Phenylalanine--tRNA ligase alpha subunit OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=pheS PE=3 SV=1 224 489 2.0E-27
sp|Q30Y15|SYFA_DESAG Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio alaskensis (strain G20) GN=pheS PE=3 SV=1 218 496 2.0E-27
sp|Q0BLJ8|SYFA_FRATO Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=pheS PE=3 SV=1 133 503 2.0E-27
sp|Q2A322|SYFA_FRATH Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. holarctica (strain LVS) GN=pheS PE=3 SV=1 133 503 2.0E-27
sp|A7NCN7|SYFA_FRATF Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=pheS PE=3 SV=1 133 503 2.0E-27
sp|Q3Z9I8|SYFA_DEHM1 Phenylalanine--tRNA ligase alpha subunit OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pheS PE=3 SV=1 224 489 2.0E-27
sp|Q6AGD7|SYFA_LEIXX Phenylalanine--tRNA ligase alpha subunit OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pheS PE=3 SV=1 213 491 2.0E-27
sp|C5BSQ6|SYFA_TERTT Phenylalanine--tRNA ligase alpha subunit OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pheS PE=3 SV=1 218 503 2.0E-27
sp|A9ILQ3|SYFA_BART1 Phenylalanine--tRNA ligase alpha subunit OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pheS PE=3 SV=1 219 489 2.0E-27
sp|A0M6W9|SYFA_GRAFK Phenylalanine--tRNA ligase alpha subunit OS=Gramella forsetii (strain KT0803) GN=pheS PE=3 SV=1 224 503 2.0E-27
sp|Q2KDK0|SYFA_RHIEC Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pheS PE=3 SV=1 224 496 2.0E-27
sp|A0PZN8|SYFA_CLONN Phenylalanine--tRNA ligase alpha subunit OS=Clostridium novyi (strain NT) GN=pheS PE=3 SV=1 218 503 2.0E-27
sp|B1HWA2|SYFA_LYSSC Phenylalanine--tRNA ligase alpha subunit OS=Lysinibacillus sphaericus (strain C3-41) GN=pheS PE=3 SV=1 218 489 2.0E-27
sp|B3EEB7|SYFA_CHLL2 Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pheS PE=3 SV=1 218 506 2.0E-27
sp|B4SB89|SYFA_PELPB Phenylalanine--tRNA ligase alpha subunit OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=pheS PE=3 SV=1 136 492 2.0E-27
sp|B3PYE2|SYFA_RHIE6 Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium etli (strain CIAT 652) GN=pheS PE=3 SV=1 224 496 3.0E-27
sp|Q6G5E3|SYFA_BARHE Phenylalanine--tRNA ligase alpha subunit OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pheS PE=3 SV=1 224 489 3.0E-27
sp|Q2N631|SYFA_ERYLH Phenylalanine--tRNA ligase alpha subunit OS=Erythrobacter litoralis (strain HTCC2594) GN=pheS PE=3 SV=1 221 489 3.0E-27
sp|Q0VNG2|SYFA_ALCBS Phenylalanine--tRNA ligase alpha subunit OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pheS PE=3 SV=1 218 489 3.0E-27
sp|B9J7G4|SYFA_AGRRK Phenylalanine--tRNA ligase alpha subunit OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pheS PE=3 SV=1 224 496 3.0E-27
sp|A6VYH7|SYFA_MARMS Phenylalanine--tRNA ligase alpha subunit OS=Marinomonas sp. (strain MWYL1) GN=pheS PE=3 SV=1 218 503 3.0E-27
sp|Q1WTY9|SYFA_LACS1 Phenylalanine--tRNA ligase alpha subunit OS=Lactobacillus salivarius (strain UCC118) GN=pheS PE=3 SV=1 141 491 3.0E-27
sp|A7MVJ5|SYFA_VIBCB Phenylalanine--tRNA ligase alpha subunit OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pheS PE=3 SV=1 224 503 4.0E-27
sp|A4XTS5|SYFA_PSEMY Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas mendocina (strain ymp) GN=pheS PE=3 SV=1 90 501 4.0E-27
sp|A0Q6A6|SYFA_FRATN Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. novicida (strain U112) GN=pheS PE=3 SV=1 133 503 4.0E-27
sp|Q2GAI8|SYFA_NOVAD Phenylalanine--tRNA ligase alpha subunit OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pheS PE=3 SV=1 220 489 4.0E-27
sp|Q7MK39|SYFA_VIBVY Phenylalanine--tRNA ligase alpha subunit OS=Vibrio vulnificus (strain YJ016) GN=pheS PE=3 SV=1 224 503 5.0E-27
sp|Q8DA40|SYFA_VIBVU Phenylalanine--tRNA ligase alpha subunit OS=Vibrio vulnificus (strain CMCP6) GN=pheS PE=3 SV=1 224 503 5.0E-27
sp|B2SGL8|SYFA_FRATM Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=pheS PE=3 SV=1 133 503 5.0E-27
sp|A8LLH4|SYFA_DINSH Phenylalanine--tRNA ligase alpha subunit OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pheS PE=3 SV=1 218 489 5.0E-27
sp|C0QT55|SYFA_PERMH Phenylalanine--tRNA ligase alpha subunit OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=pheS PE=3 SV=1 223 508 5.0E-27
sp|Q6MT17|SYFA_MYCMS Phenylalanine--tRNA ligase alpha subunit OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=pheS PE=3 SV=1 125 503 5.0E-27
sp|A0KKP5|SYFA_AERHH Phenylalanine--tRNA ligase alpha subunit OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pheS PE=3 SV=1 224 503 5.0E-27
sp|C3MCQ0|SYFA_RHISN Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium sp. (strain NGR234) GN=pheS PE=3 SV=1 224 496 6.0E-27
sp|Q74D00|SYFA_GEOSL Phenylalanine--tRNA ligase alpha subunit OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pheS PE=3 SV=1 218 496 6.0E-27
sp|A5IIW2|SYFA_THEP1 Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pheS PE=3 SV=1 218 496 6.0E-27
sp|A4SMA8|SYFA_AERS4 Phenylalanine--tRNA ligase alpha subunit OS=Aeromonas salmonicida (strain A449) GN=pheS PE=3 SV=1 224 503 6.0E-27
sp|B1YJZ8|SYFA_EXIS2 Phenylalanine--tRNA ligase alpha subunit OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=pheS PE=3 SV=1 218 499 7.0E-27
sp|Q39VS5|SYFA_GEOMG Phenylalanine--tRNA ligase alpha subunit OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pheS PE=3 SV=1 224 496 7.0E-27
sp|B1LCK9|SYFA_THESQ Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga sp. (strain RQ2) GN=pheS PE=3 SV=1 218 496 7.0E-27
sp|Q9WZS8|SYFA_THEMA Phenylalanine--tRNA ligase alpha subunit OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pheS PE=3 SV=1 218 496 7.0E-27
sp|A4IXV3|SYFA_FRATW Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=pheS PE=3 SV=1 133 503 7.0E-27
sp|Q5NG53|SYFA_FRATT Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pheS PE=3 SV=1 133 503 7.0E-27
sp|Q14HK5|SYFA_FRAT1 Phenylalanine--tRNA ligase alpha subunit OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=pheS PE=3 SV=1 133 503 7.0E-27
sp|B5ZXS0|SYFA_RHILW Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pheS PE=3 SV=1 224 496 8.0E-27
sp|A9H167|SYFA_GLUDA Phenylalanine--tRNA ligase alpha subunit OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=pheS PE=3 SV=1 221 489 8.0E-27
sp|Q3MB99|SYFA_ANAVT Phenylalanine--tRNA ligase alpha subunit OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pheS PE=3 SV=1 224 503 8.0E-27
sp|Q3ZZD3|SYFA_DEHMC Phenylalanine--tRNA ligase alpha subunit OS=Dehalococcoides mccartyi (strain CBDB1) GN=pheS PE=3 SV=1 224 489 8.0E-27
sp|A5FS95|SYFA_DEHMB Phenylalanine--tRNA ligase alpha subunit OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pheS PE=3 SV=1 224 489 8.0E-27
sp|B3QRM0|SYFA_CHLP8 Phenylalanine--tRNA ligase alpha subunit OS=Chlorobaculum parvum (strain NCIB 8327) GN=pheS PE=3 SV=1 95 498 8.0E-27
sp|Q8YMT4|SYFA_NOSS1 Phenylalanine--tRNA ligase alpha subunit OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pheS PE=3 SV=1 224 503 9.0E-27
sp|A5G4T3|SYFA_GEOUR Phenylalanine--tRNA ligase alpha subunit OS=Geobacter uraniireducens (strain Rf4) GN=pheS PE=3 SV=1 218 503 9.0E-27
sp|A5FLW1|SYFA_FLAJ1 Phenylalanine--tRNA ligase alpha subunit OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pheS PE=3 SV=1 224 503 1.0E-26
sp|A0AHW2|SYFA_LISW6 Phenylalanine--tRNA ligase alpha subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pheS PE=3 SV=1 146 503 1.0E-26
sp|Q15SX7|SYFA_PSEA6 Phenylalanine--tRNA ligase alpha subunit OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|C1DDA2|SYFA_LARHH Phenylalanine--tRNA ligase alpha subunit OS=Laribacter hongkongensis (strain HLHK9) GN=pheS PE=3 SV=1 218 503 1.0E-26
sp|Q8KAM6|SYFA_CHLTE Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pheS PE=3 SV=1 224 498 1.0E-26
sp|Q8XZ25|SYFA_RALSO Phenylalanine--tRNA ligase alpha subunit OS=Ralstonia solanacearum (strain GMI1000) GN=pheS PE=3 SV=1 218 489 1.0E-26
sp|Q9A9E4|SYFA_CAUCR Phenylalanine--tRNA ligase alpha subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pheS PE=3 SV=1 224 509 1.0E-26
sp|B8H307|SYFA_CAUCN Phenylalanine--tRNA ligase alpha subunit OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pheS PE=3 SV=1 224 509 1.0E-26
sp|Q8FTP1|SYFA_COREF Phenylalanine--tRNA ligase alpha subunit OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pheS PE=3 SV=2 223 492 1.0E-26
sp|A1ARE1|SYFA_PELPD Phenylalanine--tRNA ligase alpha subunit OS=Pelobacter propionicus (strain DSM 2379) GN=pheS PE=3 SV=1 218 496 1.0E-26
sp|Q5QXL7|SYFA_IDILO Phenylalanine--tRNA ligase alpha subunit OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|Q5GTJ5|SYFA_WOLTR Phenylalanine--tRNA ligase alpha subunit OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pheS PE=3 SV=1 221 496 2.0E-26
sp|C3LLR5|SYFA_VIBCM Phenylalanine--tRNA ligase alpha subunit OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pheS PE=3 SV=1 224 503 2.0E-26
sp|Q9KSN7|SYFA_VIBCH Phenylalanine--tRNA ligase alpha subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pheS PE=3 SV=1 224 503 2.0E-26
sp|A5F1W4|SYFA_VIBC3 Phenylalanine--tRNA ligase alpha subunit OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pheS PE=3 SV=1 224 503 2.0E-26
sp|B0U0C4|SYFA_FRAP2 Phenylalanine--tRNA ligase alpha subunit OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|B2UGJ4|SYFA_RALPJ Phenylalanine--tRNA ligase alpha subunit OS=Ralstonia pickettii (strain 12J) GN=pheS PE=3 SV=1 218 489 2.0E-26
sp|B2IGL6|SYFA_BEII9 Phenylalanine--tRNA ligase alpha subunit OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=pheS PE=3 SV=1 182 489 2.0E-26
sp|Q7N3Q0|SYFA_PHOLL Phenylalanine--tRNA ligase alpha subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pheS PE=3 SV=1 176 503 2.0E-26
sp|Q6LQ72|SYFA_PHOPR Phenylalanine--tRNA ligase alpha subunit OS=Photobacterium profundum GN=pheS PE=3 SV=2 224 503 2.0E-26
sp|Q6YPX9|SYFA_ONYPE Phenylalanine--tRNA ligase alpha subunit OS=Onion yellows phytoplasma (strain OY-M) GN=pheS PE=3 SV=1 224 503 2.0E-26
sp|A7GHZ8|SYFA_CLOBL Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|Q8NQN7|SYFA_CORGL Phenylalanine--tRNA ligase alpha subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pheS PE=3 SV=1 221 492 2.0E-26
sp|C3KTJ3|SYFA_CLOB6 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain 657 / Type Ba4) GN=pheS PE=3 SV=1 218 503 2.0E-26
sp|A4SCK0|SYFA_CHLPM Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=pheS PE=3 SV=1 223 498 2.0E-26
sp|B5FDX4|SYFA_VIBFM Phenylalanine--tRNA ligase alpha subunit OS=Vibrio fischeri (strain MJ11) GN=pheS PE=3 SV=1 224 503 2.0E-26
sp|Q5E5G6|SYFA_VIBF1 Phenylalanine--tRNA ligase alpha subunit OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pheS PE=3 SV=1 224 503 2.0E-26
sp|Q87Q60|SYFA_VIBPA Phenylalanine--tRNA ligase alpha subunit OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pheS PE=3 SV=1 224 503 3.0E-26
sp|C4LFG9|SYFA_TOLAT Phenylalanine--tRNA ligase alpha subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pheS PE=3 SV=1 224 503 3.0E-26
sp|B7VPK0|SYFA_VIBTL Phenylalanine--tRNA ligase alpha subunit OS=Vibrio tasmaniensis (strain LGP32) GN=pheS PE=3 SV=1 224 503 3.0E-26
sp|B1IML3|SYFA_CLOBK Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Okra / Type B1) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|C1FKM3|SYFA_CLOBJ Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|A5I6L1|SYFA_CLOBH Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|A7FY80|SYFA_CLOB1 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=pheS PE=3 SV=1 218 503 3.0E-26
sp|A1B4B8|SYFA_PARDP Phenylalanine--tRNA ligase alpha subunit OS=Paracoccus denitrificans (strain Pd 1222) GN=pheS PE=3 SV=1 218 489 3.0E-26
sp|Q5LMG9|SYFA_RUEPO Phenylalanine--tRNA ligase alpha subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pheS PE=3 SV=1 220 489 3.0E-26
sp|Q3APW3|SYFA_CHLCH Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium chlorochromatii (strain CaD3) GN=pheS PE=3 SV=1 218 498 3.0E-26
sp|Q92CI7|SYFA_LISIN Phenylalanine--tRNA ligase alpha subunit OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pheS PE=3 SV=1 143 503 3.0E-26
sp|B1L0T0|SYFA_CLOBM Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pheS PE=3 SV=1 218 503 4.0E-26
sp|Q6NHH2|SYFA_CORDI Phenylalanine--tRNA ligase alpha subunit OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pheS PE=3 SV=1 221 492 4.0E-26
sp|Q47ZS4|SYFA_COLP3 Phenylalanine--tRNA ligase alpha subunit OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pheS PE=3 SV=1 218 503 4.0E-26
sp|Q1GDM3|SYFA_RUEST Phenylalanine--tRNA ligase alpha subunit OS=Ruegeria sp. (strain TM1040) GN=pheS PE=3 SV=1 224 489 4.0E-26
sp|Q828C7|SYFA_STRAW Phenylalanine--tRNA ligase alpha subunit OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pheS PE=3 SV=1 223 492 4.0E-26
sp|Q47N75|SYFA_THEFY Phenylalanine--tRNA ligase alpha subunit OS=Thermobifida fusca (strain YX) GN=pheS PE=3 SV=1 224 492 4.0E-26
sp|Q6G0Y4|SYFA_BARQU Phenylalanine--tRNA ligase alpha subunit OS=Bartonella quintana (strain Toulouse) GN=pheS PE=3 SV=1 224 489 4.0E-26
sp|Q5HC40|SYFA_EHRRW Phenylalanine--tRNA ligase alpha subunit OS=Ehrlichia ruminantium (strain Welgevonden) GN=pheS PE=3 SV=1 221 491 4.0E-26
sp|Q5FH45|SYFA_EHRRG Phenylalanine--tRNA ligase alpha subunit OS=Ehrlichia ruminantium (strain Gardel) GN=pheS PE=3 SV=1 221 491 4.0E-26
sp|A1VBB8|SYFA_DESVV Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=pheS PE=3 SV=1 224 496 4.0E-26
sp|Q728R9|SYFA_DESVH Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pheS PE=3 SV=1 224 496 4.0E-26
sp|Q7NGP0|SYFA_GLOVI Phenylalanine--tRNA ligase alpha subunit OS=Gloeobacter violaceus (strain PCC 7421) GN=pheS PE=3 SV=1 224 503 5.0E-26
sp|B6EN08|SYFA_ALISL Phenylalanine--tRNA ligase alpha subunit OS=Aliivibrio salmonicida (strain LFI1238) GN=pheS PE=3 SV=1 224 503 5.0E-26
sp|B3PL12|SYFA_CELJU Phenylalanine--tRNA ligase alpha subunit OS=Cellvibrio japonicus (strain Ueda107) GN=pheS PE=3 SV=1 218 503 5.0E-26
sp|B2TS55|SYFA_CLOBB Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pheS PE=3 SV=1 218 503 5.0E-26
sp|B2V594|SYFA_CLOBA Phenylalanine--tRNA ligase alpha subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pheS PE=3 SV=1 218 503 5.0E-26
sp|A1BJB6|SYFA_CHLPD Phenylalanine--tRNA ligase alpha subunit OS=Chlorobium phaeobacteroides (strain DSM 266) GN=pheS PE=3 SV=1 224 506 6.0E-26
sp|Q2GHR3|SYFA_EHRCR Phenylalanine--tRNA ligase alpha subunit OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=pheS PE=3 SV=1 226 496 6.0E-26
sp|A4G615|SYFA_HERAR Phenylalanine--tRNA ligase alpha subunit OS=Herminiimonas arsenicoxydans GN=pheS PE=3 SV=1 218 503 7.0E-26
sp|A5D0U1|SYFA_PELTS Phenylalanine--tRNA ligase alpha subunit OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pheS PE=3 SV=1 223 503 8.0E-26
sp|Q9JR76|SYFA_NEIMA Phenylalanine--tRNA ligase alpha subunit OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pheS PE=3 SV=1 218 503 8.0E-26
sp|Q8EYR3|SYFA_LEPIN Phenylalanine--tRNA ligase alpha subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pheS PE=3 SV=1 219 489 8.0E-26
sp|Q72M80|SYFA_LEPIC Phenylalanine--tRNA ligase alpha subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pheS PE=3 SV=1 219 489 8.0E-26
sp|Q8Y7Q2|SYFA_LISMO Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pheS PE=3 SV=1 218 503 8.0E-26
sp|Q60AZ0|SYFA_METCA Phenylalanine--tRNA ligase alpha subunit OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pheS PE=3 SV=1 218 501 9.0E-26
sp|A6LTR7|SYFA_CLOB8 Phenylalanine--tRNA ligase alpha subunit OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pheS PE=3 SV=1 218 503 9.0E-26
sp|B3R4J5|SYFA_CUPTR Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pheS PE=3 SV=1 224 489 9.0E-26
sp|B8DI11|SYFA_LISMH Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pheS PE=3 SV=1 218 503 1.0E-25
sp|Q720K8|SYFA_LISMF Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pheS PE=3 SV=1 218 503 1.0E-25
sp|Q5F9U0|SYFA_NEIG1 Phenylalanine--tRNA ligase alpha subunit OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pheS PE=3 SV=2 218 503 1.0E-25
sp|B0SXZ7|SYFA_CAUSK Phenylalanine--tRNA ligase alpha subunit OS=Caulobacter sp. (strain K31) GN=pheS PE=3 SV=1 224 491 1.0E-25
sp|Q472N4|SYFA_CUPPJ Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pheS PE=3 SV=1 224 489 1.0E-25
sp|B1MXE0|SYFA_LEUCK Phenylalanine--tRNA ligase alpha subunit OS=Leuconostoc citreum (strain KM20) GN=pheS PE=3 SV=1 218 496 1.0E-25
sp|Q9K092|SYFA_NEIMB Phenylalanine--tRNA ligase alpha subunit OS=Neisseria meningitidis serogroup B (strain MC58) GN=pheS PE=3 SV=1 218 503 1.0E-25
sp|Q0KBY9|SYFA_CUPNH Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pheS PE=3 SV=1 224 489 1.0E-25
sp|Q6MDC0|SYFA_PARUW Phenylalanine--tRNA ligase alpha subunit OS=Protochlamydia amoebophila (strain UWE25) GN=pheS PE=3 SV=1 218 503 1.0E-25
sp|A6SY34|SYFA_JANMA Phenylalanine--tRNA ligase alpha subunit OS=Janthinobacterium sp. (strain Marseille) GN=pheS PE=3 SV=1 218 503 1.0E-25
sp|Q2RNH8|SYFA_RHORT Phenylalanine--tRNA ligase alpha subunit OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pheS PE=3 SV=1 221 489 1.0E-25
sp|B3QUV1|SYFA_CHLT3 Phenylalanine--tRNA ligase alpha subunit OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=pheS PE=3 SV=1 95 489 2.0E-25
sp|Q056G0|SYFA_LEPBL Phenylalanine--tRNA ligase alpha subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pheS PE=3 SV=1 224 489 2.0E-25
sp|Q04P74|SYFA_LEPBJ Phenylalanine--tRNA ligase alpha subunit OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pheS PE=3 SV=1 224 489 2.0E-25
sp|Q3A4N9|SYFA_PELCD Phenylalanine--tRNA ligase alpha subunit OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pheS PE=3 SV=1 218 496 2.0E-25
sp|B2V6V0|SYFA_SULSY Phenylalanine--tRNA ligase alpha subunit OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=pheS PE=3 SV=1 225 500 2.0E-25
sp|Q5WEJ5|SYFA_BACSK Phenylalanine--tRNA ligase alpha subunit OS=Bacillus clausii (strain KSM-K16) GN=pheS PE=3 SV=1 224 501 2.0E-25
sp|B4R9C6|SYFA_PHEZH Phenylalanine--tRNA ligase alpha subunit OS=Phenylobacterium zucineum (strain HLK1) GN=pheS PE=3 SV=1 224 496 2.0E-25
sp|A2SH03|SYFA_METPP Phenylalanine--tRNA ligase alpha subunit OS=Methylibium petroleiphilum (strain PM1) GN=pheS PE=3 SV=1 218 501 2.0E-25
sp|Q98CP9|SYFA_RHILO Phenylalanine--tRNA ligase alpha subunit OS=Rhizobium loti (strain MAFF303099) GN=pheS PE=3 SV=1 224 496 2.0E-25
sp|B4ETL0|SYFA_PROMH Phenylalanine--tRNA ligase alpha subunit OS=Proteus mirabilis (strain HI4320) GN=pheS PE=3 SV=1 224 503 2.0E-25
sp|B8E7F5|SYFA_SHEB2 Phenylalanine--tRNA ligase alpha subunit OS=Shewanella baltica (strain OS223) GN=pheS PE=3 SV=1 218 503 2.0E-25
sp|Q4ZUG3|SYFA_PSEU2 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pheS PE=3 SV=1 218 501 3.0E-25
sp|Q48JR9|SYFA_PSE14 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pheS PE=3 SV=1 218 501 3.0E-25
sp|Q883H8|SYFA_PSESM Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pheS PE=3 SV=1 218 501 3.0E-25
sp|A6L2I3|SYFA_BACV8 Phenylalanine--tRNA ligase alpha subunit OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=pheS PE=3 SV=1 224 489 3.0E-25
sp|Q82VV5|SYFA_NITEU Phenylalanine--tRNA ligase alpha subunit OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=pheS PE=3 SV=1 218 503 3.0E-25
sp|A6WMK4|SYFA_SHEB8 Phenylalanine--tRNA ligase alpha subunit OS=Shewanella baltica (strain OS185) GN=pheS PE=3 SV=1 218 503 3.0E-25
sp|Q4JW06|SYFA_CORJK Phenylalanine--tRNA ligase alpha subunit OS=Corynebacterium jeikeium (strain K411) GN=pheS PE=3 SV=1 224 492 3.0E-25
sp|A1RK14|SYFA_SHESW Phenylalanine--tRNA ligase alpha subunit OS=Shewanella sp. (strain W3-18-1) GN=pheS PE=3 SV=1 218 503 3.0E-25
sp|A4Y6G8|SYFA_SHEPC Phenylalanine--tRNA ligase alpha subunit OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pheS PE=3 SV=1 218 503 3.0E-25
sp|B8IP76|SYFA_METNO Phenylalanine--tRNA ligase alpha subunit OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=pheS PE=3 SV=1 221 489 3.0E-25
sp|Q97GK9|SYFA_CLOAB Phenylalanine--tRNA ligase alpha subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pheS PE=3 SV=1 218 503 4.0E-25
sp|Q4FQ65|SYFA_PSYA2 Phenylalanine--tRNA ligase alpha subunit OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pheS PE=3 SV=1 224 503 4.0E-25
sp|Q5PBV2|SYFA_ANAMM Phenylalanine--tRNA ligase alpha subunit OS=Anaplasma marginale (strain St. Maries) GN=pheS PE=3 SV=1 221 497 5.0E-25
sp|A1A1X6|SYFA_BIFAA Phenylalanine--tRNA ligase alpha subunit OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pheS PE=3 SV=1 211 499 5.0E-25
sp|Q8P7Z5|SYFA_XANCP Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pheS PE=3 SV=1 224 496 5.0E-25
sp|B0RRH3|SYFA_XANCB Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas campestris pv. campestris (strain B100) GN=pheS PE=3 SV=1 224 496 5.0E-25
sp|Q4UW53|SYFA_XANC8 Phenylalanine--tRNA ligase alpha subunit OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pheS PE=3 SV=1 224 496 5.0E-25
sp|Q16BG6|SYFA_ROSDO Phenylalanine--tRNA ligase alpha subunit OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pheS PE=3 SV=1 224 511 5.0E-25
sp|Q3Z262|SYFA_SHISS Phenylalanine--tRNA ligase alpha subunit OS=Shigella sonnei (strain Ss046) GN=pheS PE=3 SV=1 217 503 5.0E-25
sp|Q9RRX8|SYFA_DEIRA Phenylalanine--tRNA ligase alpha subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pheS PE=3 SV=1 223 489 5.0E-25
sp|A9B8B9|SYFA_HERA2 Phenylalanine--tRNA ligase alpha subunit OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pheS PE=3 SV=1 187 503 6.0E-25
sp|A1U2B9|SYFA_MARHV Phenylalanine--tRNA ligase alpha subunit OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pheS PE=3 SV=1 218 501 6.0E-25
sp|Q1LP76|SYFA_CUPMC Phenylalanine--tRNA ligase alpha subunit OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pheS PE=3 SV=1 224 489 6.0E-25
sp|Q88WR3|SYFA_LACPL Phenylalanine--tRNA ligase alpha subunit OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pheS PE=3 SV=1 218 491 6.0E-25
sp|Q3KEX8|SYFA_PSEPF Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas fluorescens (strain Pf0-1) GN=pheS PE=3 SV=1 218 501 6.0E-25
sp|Q0AY00|SYFA_SYNWW Phenylalanine--tRNA ligase alpha subunit OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=pheS PE=3 SV=1 218 489 7.0E-25
sp|C1A492|SYFA_GEMAT Phenylalanine--tRNA ligase alpha subunit OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=pheS PE=3 SV=1 224 503 8.0E-25
sp|C5B850|SYFA_EDWI9 Phenylalanine--tRNA ligase alpha subunit OS=Edwardsiella ictaluri (strain 93-146) GN=pheS PE=3 SV=1 218 503 8.0E-25
sp|Q7VVR4|SYFA_BORPE Phenylalanine--tRNA ligase alpha subunit OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pheS PE=3 SV=1 218 501 9.0E-25
sp|Q7WKR5|SYFA_BORBR Phenylalanine--tRNA ligase alpha subunit OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pheS PE=3 SV=1 218 501 9.0E-25
sp|B1XYZ7|SYFA_LEPCP Phenylalanine--tRNA ligase alpha subunit OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pheS PE=3 SV=1 218 501 9.0E-25
sp|Q0HUP8|SYFA_SHESR Phenylalanine--tRNA ligase alpha subunit OS=Shewanella sp. (strain MR-7) GN=pheS PE=3 SV=1 218 503 1.0E-24
sp|Q5YYH7|SYFA_NOCFA Phenylalanine--tRNA ligase alpha subunit OS=Nocardia farcinica (strain IFM 10152) GN=pheS PE=3 SV=1 221 492 1.0E-24
sp|Q8DL09|SYFA_THEEB Phenylalanine--tRNA ligase alpha subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|Q4KEW0|SYFA_PSEF5 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pheS PE=3 SV=1 218 501 1.0E-24
sp|B6IPK0|SYFA_RHOCS Phenylalanine--tRNA ligase alpha subunit OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pheS PE=3 SV=1 224 510 1.0E-24
sp|Q1IC11|SYFA_PSEE4 Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas entomophila (strain L48) GN=pheS PE=3 SV=1 88 501 1.0E-24
sp|C3JZN3|SYFA_PSEFS Phenylalanine--tRNA ligase alpha subunit OS=Pseudomonas fluorescens (strain SBW25) GN=pheS PE=3 SV=1 88 501 1.0E-24
sp|Q6D4H2|SYFA_PECAS Phenylalanine--tRNA ligase alpha subunit OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|Q321K6|SYFA_SHIBS Phenylalanine--tRNA ligase alpha subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|P08312|SYFA_ECOLI Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12) GN=pheS PE=1 SV=2 224 503 1.0E-24
sp|B1IPL3|SYFA_ECOLC Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|A8A0Q6|SYFA_ECOHS Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O9:H4 (strain HS) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|B1XG21|SYFA_ECODH Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12 / DH10B) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|C4ZYH6|SYFA_ECOBW Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|B7M1C3|SYFA_ECO8A Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O8 (strain IAI1) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|A7ZMI2|SYFA_ECO24 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pheS PE=3 SV=1 224 503 1.0E-24
sp|Q2NT28|SYFA_SODGM Phenylalanine--tRNA ligase alpha subunit OS=Sodalis glossinidius (strain morsitans) GN=pheS PE=3 SV=1 218 503 1.0E-24
sp|C1L2C6|SYFA_LISMC Phenylalanine--tRNA ligase alpha subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pheS PE=3 SV=1 218 503 1.0E-24
sp|Q7VR67|SYFA_BLOFL Phenylalanine--tRNA ligase alpha subunit OS=Blochmannia floridanus GN=pheS PE=3 SV=1 223 503 2.0E-24
sp|Q7NYC2|SYFA_CHRVO Phenylalanine--tRNA ligase alpha subunit OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pheS PE=3 SV=1 218 503 2.0E-24
sp|B3E1T9|SYFA_GEOLS Phenylalanine--tRNA ligase alpha subunit OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pheS PE=3 SV=1 141 496 2.0E-24
sp|B8DPM8|SYFA_DESVM Phenylalanine--tRNA ligase alpha subunit OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=pheS PE=3 SV=1 224 496 2.0E-24
sp|Q0T4S4|SYFA_SHIF8 Phenylalanine--tRNA ligase alpha subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B7LQ75|SYFA_ESCF3 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B1LE16|SYFA_ECOSM Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B6I8Q7|SYFA_ECOSE Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain SE11) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B7N552|SYFA_ECOLU Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|P67036|SYFA_ECOL6 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|Q0THB4|SYFA_ECOL5 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B7MVJ3|SYFA_ECO81 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O81 (strain ED1a) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B7NT62|SYFA_ECO7I Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B5YQ02|SYFA_ECO5E Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|P67037|SYFA_ECO57 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O157:H7 GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B7L6I7|SYFA_ECO55 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli (strain 55989 / EAEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B7MAS5|SYFA_ECO45 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B7US97|SYFA_ECO27 Phenylalanine--tRNA ligase alpha subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|Q8RHB4|SYFA_FUSNN Phenylalanine--tRNA ligase alpha subunit OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pheS PE=3 SV=1 218 503 2.0E-24
sp|Q32FI5|SYFA_SHIDS Phenylalanine--tRNA ligase alpha subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B0UPJ5|SYFA_METS4 Phenylalanine--tRNA ligase alpha subunit OS=Methylobacterium sp. (strain 4-46) GN=pheS PE=3 SV=1 221 489 2.0E-24
sp|B2U392|SYFA_SHIB3 Phenylalanine--tRNA ligase alpha subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|A1S702|SYFA_SHEAM Phenylalanine--tRNA ligase alpha subunit OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pheS PE=3 SV=1 151 503 2.0E-24
sp|Q3YSX1|SYFA_EHRCJ Phenylalanine--tRNA ligase alpha subunit OS=Ehrlichia canis (strain Jake) GN=pheS PE=3 SV=1 226 496 2.0E-24
sp|B5XQD0|SYFA_KLEP3 Phenylalanine--tRNA ligase alpha subunit OS=Klebsiella pneumoniae (strain 342) GN=pheS PE=3 SV=1 224 503 2.0E-24
sp|B3WF19|SYFA_LACCB Phenylalanine--tRNA ligase alpha subunit OS=Lactobacillus casei (strain BL23) GN=pheS PE=3 SV=1 218 501 2.0E-24
sp|Q2SDJ6|SYFA_HAHCH Phenylalanine--tRNA ligase alpha subunit OS=Hahella chejuensis (strain KCTC 2396) GN=pheS PE=3 SV=1 218 503 3.0E-24
sp|A6TAI3|SYFA_KLEP7 Phenylalanine--tRNA ligase alpha subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pheS PE=3 SV=1 224 503 3.0E-24
sp|Q6A7V5|SYFA_PROAC Phenylalanine--tRNA ligase alpha subunit OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pheS PE=3 SV=1 79 499 3.0E-24
sp|C1CYT5|SYFA_DEIDV Phenylalanine--tRNA ligase alpha subunit OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pheS PE=3 SV=1 223 489 3.0E-24
sp|Q8EFA0|SYFA_SHEON Phenylalanine--tRNA ligase alpha subunit OS=Shewanella oneidensis (strain MR-1) GN=pheS PE=3 SV=1 224 503 3.0E-24
sp|B4T4N2|SYFA_SALNS Phenylalanine--tRNA ligase alpha subunit OS=Salmonella newport (strain SL254) GN=pheS PE=3 SV=1 224 503 3.0E-24
sp|C6DFZ0|SYFA_PECCP Phenylalanine--tRNA ligase alpha subunit OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pheS PE=3 SV=1 224 503 3.0E-24
sp|A7MNY9|SYFA_CROS8 Phenylalanine--tRNA ligase alpha subunit OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|Q6F872|SYFA_ACIAD Phenylalanine--tRNA ligase alpha subunit OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pheS PE=3 SV=1 218 503 4.0E-24
sp|P67038|SYFA_SALTY Phenylalanine--tRNA ligase alpha subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|P67039|SYFA_SALTI Phenylalanine--tRNA ligase alpha subunit OS=Salmonella typhi GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|B4TUF4|SYFA_SALSV Phenylalanine--tRNA ligase alpha subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|B5BA38|SYFA_SALPK Phenylalanine--tRNA ligase alpha subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|C0Q642|SYFA_SALPC Phenylalanine--tRNA ligase alpha subunit OS=Salmonella paratyphi C (strain RKS4594) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|A9N238|SYFA_SALPB Phenylalanine--tRNA ligase alpha subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|Q5PH92|SYFA_SALPA Phenylalanine--tRNA ligase alpha subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|B4TGH5|SYFA_SALHS Phenylalanine--tRNA ligase alpha subunit OS=Salmonella heidelberg (strain SL476) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|B5RAW9|SYFA_SALG2 Phenylalanine--tRNA ligase alpha subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|B5QVW4|SYFA_SALEP Phenylalanine--tRNA ligase alpha subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=pheS PE=3 SV=1 224 503 4.0E-24
sp|B5FJA4|SYFA_SALDC Phenylalanine--tRNA ligase alpha subunit OS=Salmonella dublin (strain CT_02021853) GN=pheS PE=3 SV=1 224 503 4.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0043039 tRNA aminoacylation Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000049 tRNA binding Yes
GO:0032553 ribonucleotide binding No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0003676 nucleic acid binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0003723 RNA binding No
GO:0016874 ligase activity No
GO:0097159 organic cyclic compound binding No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4069
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4050 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4931
Ophiocordyceps camponoti-floridani Ophcf2|07342
Ophiocordyceps camponoti-rufipedis Ophun1|862
Ophiocordyceps kimflemingae Ophio5|1521
Ophiocordyceps subramaniannii Hirsu2|8200

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4050
MTTSSPAPAGDLATCVLQALSAQSPIQSADAFPSIPSQEVKGALDRLASRSMVTYETIEREEALLEPEAETIAAH
GSHEARVFEALKQAMDGLTVQELEQVIGDKNVTKLGQGKAFREKWISKSKDGKLVATAESIQDTTRAQLQQVKES
RTADAKVLNDLKKRKLIRMQKIIAFQVAKGPKFALEMQKEETDLTADMLTSGSWKTATFKPYNFKALGSDQNAGA
LHPLNKVRHEFRQIFFEMGFEEMPTNKYVETGFWNFDALFVPQQHPARDLQDTFYISDPKAGEKPRSHEAGQDTE
AYWNNIKQVHQDGKYGSIGYRYPWSGEESLKLVLRTHTTSISAAMLHKLVATKGQDGRPKPARYFSIDRVFRNET
VDATHLAEFHQIEGVIADYGLSLGGLMEFMEIFFGKMGITDLKFKPAYNPYTEPSMEIFSFHKGLNKLVEIGNSG
MFRPEMLEAMGLPSDMRVFGWGLSLERPTMIKYKISNIRELLGHKVDLSFIERNPAVRLDQE*
Coding >OphauG2|4050
ATGACCACCTCAAGCCCTGCTCCCGCAGGCGATCTCGCGACCTGCGTGCTGCAAGCTCTGTCGGCTCAGAGCCCC
ATTCAATCTGCCGATGCCTTTCCCAGCATCCCCTCTCAGGAGGTCAAAGGCGCTCTCGACCGGCTGGCATCACGG
TCCATGGTTACATACGAGACGATTGAGCGCGAAGAAGCACTCCTGGAACCCGAGGCAGAAACTATTGCCGCCCAT
GGAAGTCATGAGGCGCGAGTCTTTGAGGCCTTGAAGCAGGCCATGGATGGCCTGACTGTCCAAGAGCTGGAACAA
GTCATTGGAGATAAGAATGTCACCAAGCTTGGCCAGGGCAAGGCCTTTCGCGAGAAGTGGATATCCAAGAGCAAA
GACGGCAAGCTCGTCGCCACTGCTGAATCCATACAAGACACCACCCGCGCCCAGCTCCAACAAGTAAAAGAGTCG
CGAACTGCCGATGCCAAGGTTCTCAACGACCTCAAGAAGCGCAAACTTATTCGCATGCAAAAGATTATAGCCTTC
CAAGTAGCAAAGGGTCCCAAATTTGCCCTCGAAATGCAAAAGGAAGAGACGGACCTCACGGCTGATATGCTCACG
TCGGGATCGTGGAAAACAGCCACCTTTAAACCTTACAACTTTAAGGCTCTGGGATCTGACCAGAACGCCGGTGCC
TTGCATCCTCTGAACAAGGTGCGGCACGAGTTCCGCCAAATCTTCTTTGAAATGGGCTTTGAGGAAATGCCGACA
AACAAGTATGTCGAGACGGGCTTCTGGAACTTTGACGCACTCTTCGTCCCGCAACAACATCCTGCACGCGATTTG
CAAGATACCTTTTATATTTCAGATCCCAAGGCTGGCGAGAAGCCGCGCTCGCACGAGGCCGGACAAGACACAGAG
GCGTATTGGAACAACATCAAACAAGTGCACCAGGATGGCAAGTATGGCTCGATTGGATATCGCTATCCATGGTCG
GGTGAGGAGTCGCTCAAGCTGGTGTTGCGTACGCATACCACCTCCATCTCGGCGGCAATGCTGCATAAACTGGTG
GCGACCAAGGGCCAGGATGGACGGCCCAAACCAGCACGATACTTTTCTATTGATCGCGTCTTCCGTAACGAAACT
GTCGATGCAACACACTTGGCCGAATTTCATCAAATCGAGGGTGTAATTGCCGATTACGGGCTGTCCCTGGGTGGA
CTGATGGAGTTTATGGAGATTTTCTTTGGCAAGATGGGTATCACAGACCTCAAGTTTAAGCCAGCCTATAACCCC
TATACGGAACCCAGCATGGAAATTTTCAGCTTCCACAAGGGTCTGAACAAGCTGGTCGAGATTGGCAACAGCGGC
ATGTTTCGCCCAGAGATGCTCGAGGCCATGGGACTGCCGAGCGACATGCGTGTCTTTGGGTGGGGTTTGAGTCTG
GAACGGCCGACGATGATCAAGTACAAGATTTCCAATATCCGCGAGCTGCTTGGGCACAAGGTCGACTTGAGCTTT
ATTGAGCGGAATCCTGCAGTAAGGTTGGACCAGGAATAG
Transcript >OphauG2|4050
ATGACCACCTCAAGCCCTGCTCCCGCAGGCGATCTCGCGACCTGCGTGCTGCAAGCTCTGTCGGCTCAGAGCCCC
ATTCAATCTGCCGATGCCTTTCCCAGCATCCCCTCTCAGGAGGTCAAAGGCGCTCTCGACCGGCTGGCATCACGG
TCCATGGTTACATACGAGACGATTGAGCGCGAAGAAGCACTCCTGGAACCCGAGGCAGAAACTATTGCCGCCCAT
GGAAGTCATGAGGCGCGAGTCTTTGAGGCCTTGAAGCAGGCCATGGATGGCCTGACTGTCCAAGAGCTGGAACAA
GTCATTGGAGATAAGAATGTCACCAAGCTTGGCCAGGGCAAGGCCTTTCGCGAGAAGTGGATATCCAAGAGCAAA
GACGGCAAGCTCGTCGCCACTGCTGAATCCATACAAGACACCACCCGCGCCCAGCTCCAACAAGTAAAAGAGTCG
CGAACTGCCGATGCCAAGGTTCTCAACGACCTCAAGAAGCGCAAACTTATTCGCATGCAAAAGATTATAGCCTTC
CAAGTAGCAAAGGGTCCCAAATTTGCCCTCGAAATGCAAAAGGAAGAGACGGACCTCACGGCTGATATGCTCACG
TCGGGATCGTGGAAAACAGCCACCTTTAAACCTTACAACTTTAAGGCTCTGGGATCTGACCAGAACGCCGGTGCC
TTGCATCCTCTGAACAAGGTGCGGCACGAGTTCCGCCAAATCTTCTTTGAAATGGGCTTTGAGGAAATGCCGACA
AACAAGTATGTCGAGACGGGCTTCTGGAACTTTGACGCACTCTTCGTCCCGCAACAACATCCTGCACGCGATTTG
CAAGATACCTTTTATATTTCAGATCCCAAGGCTGGCGAGAAGCCGCGCTCGCACGAGGCCGGACAAGACACAGAG
GCGTATTGGAACAACATCAAACAAGTGCACCAGGATGGCAAGTATGGCTCGATTGGATATCGCTATCCATGGTCG
GGTGAGGAGTCGCTCAAGCTGGTGTTGCGTACGCATACCACCTCCATCTCGGCGGCAATGCTGCATAAACTGGTG
GCGACCAAGGGCCAGGATGGACGGCCCAAACCAGCACGATACTTTTCTATTGATCGCGTCTTCCGTAACGAAACT
GTCGATGCAACACACTTGGCCGAATTTCATCAAATCGAGGGTGTAATTGCCGATTACGGGCTGTCCCTGGGTGGA
CTGATGGAGTTTATGGAGATTTTCTTTGGCAAGATGGGTATCACAGACCTCAAGTTTAAGCCAGCCTATAACCCC
TATACGGAACCCAGCATGGAAATTTTCAGCTTCCACAAGGGTCTGAACAAGCTGGTCGAGATTGGCAACAGCGGC
ATGTTTCGCCCAGAGATGCTCGAGGCCATGGGACTGCCGAGCGACATGCGTGTCTTTGGGTGGGGTTTGAGTCTG
GAACGGCCGACGATGATCAAGTACAAGATTTCCAATATCCGCGAGCTGCTTGGGCACAAGGTCGACTTGAGCTTT
ATTGAGCGGAATCCTGCAGTAAGGTTGGACCAGGAATAG
Gene >OphauG2|4050
ATGACCACCTCAAGCCCTGCTCCCGCAGGCGATCTCGCGACCTGCGTGCTGCAAGCTCTGTCGGCTCAGAGCCCC
ATTCAATCTGCCGATGCCTTTCCCAGCATCCCCTCTCAGGAGGTCAAAGGCGCTCTCGACCGGCTGGCATCACGG
TCCATGGTTACATACGAGACGATTGAGCGCGAAGAAGCACTCCTGGAACCCGAGGCAGAAACTATTGCCGCCCAT
GGAAGTCATGAGGCGCGAGTCTTTGAGGCCTTGAAGCAGGCCATGGATGGCCTGACTGTCCAAGAGCTGGAACAA
GTCATTGGAGATAAGAATGTCACCAAGCTTGGCCAGGGCAAGGCCTTTCGCGAGAAGTGGATATCCAAGAGCAAA
GACGGCAAGCTCGTCGCCACTGTACGTCGTCTTTTGTCCTCATAGCCAGAGGCCGAGAATCGTTGAGCTGATGGT
GAACCAGGCTGAATCCATACAAGACACCACCCGCGCCCAGCTCCAACAAGTAAAAGAGTCGCGAACTGCCGATGC
CAAGGTTCTCAACGACCTCAAGAAGCGCAAACTTATTCGCATGCAAAAGATTATAGCCTTCCAAGTAGCAAAGGG
TCCCAAATTTGCCCTCGAAATGCAAAAGGAAGAGACGGACCTCACGGCTGATATGCTCACGTCGGGATCGTGGAA
AACAGCCACCTTTAAACCTTACAACTTTAAGGCTCTGGGATCTGACCAGAACGCCGGTGCCTTGCATCCTCTGAA
CAAGGTGCGGCACGAGTTCCGCCAAATCTTCTTTGAAATGGGCTTTGAGGAAATGCCGACAAACAAGTATGTCGA
GACGGGCTTCTGGAACTTTGACGCACTCTTCGTCCCGCAACAACATCCTGCACGCGATTTGCAAGATACCTTTTA
TATTTCAGATCCCAAGGCTGGCGAGAAGCCGCGCTCGCACGAGGCCGGACAAGACACAGAGGCGTATTGGAACAA
CATCAAACAAGTGCACCAGGATGGCAAGTATGGCTCGATTGGATATCGCTATCCATGGTCGGGTGAGGAGTCGCT
CAAGCTGGTGTTGCGTACGCATACCACCTCCATCTCGGCGGCAATGCTGCATAAACTGGTGGCGACCAAGGGCCA
GGATGGACGGCCCAAACCAGCACGATACTTTTCTATTGATCGCGTCTTCCGTAACGAAACTGTCGATGCAACACA
CTTGGCCGAATTTCATCAAATCGAGGGTGTAATTGCCGATTACGGGCTGTCCCTGGGTGGACTGATGGAGTTTAT
GGAGATTTTCTTTGGCAAGATGGGTATCACAGACCTCAAGTTTAAGCCAGCCTATAACCCCTATACGGAACCCAG
CATGGAAATTTTCAGCTTCCACAAGGGTCTGAACAAGCTGGTCGAGATTGGCAACAGCGGCATGTTTCGCCCAGA
GATGCTCGAGGCCATGGGACTGCCGAGCGACATGCGTGTCTTTGGGTGGGGTTTGAGTCTGGAACGGCCGACGAT
GATCAAGTACAAGATTTCCAATATCCGCGAGCTGCTTGGGCACAAGGTCGACTTGAGCTTTATTGAGCGGAATCC
TGCAGTAAGGTTGGACCAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail